Property Summary

NCBI Gene PubMed Count 66
Grant Count 35
R01 Count 21
Funding $5,648,271.74
PubMed Score 184.98
PubTator Score 126.71

Knowledge Summary

Patent (10,885)

Expression

  Differential Expression (26)

Disease log2 FC p
Rheumatoid Arthritis 1.300 0.032
psoriasis -1.600 0.000
osteosarcoma -2.208 0.001
group 3 medulloblastoma -1.600 0.003
astrocytoma 2.400 0.006
glioblastoma 1.200 0.026
atypical teratoid/rhabdoid tumor -1.300 0.000
medulloblastoma, large-cell -2.100 0.000
acute quadriplegic myopathy 1.440 0.013
type 2 diabetes -1.208 0.043
tuberculosis and treatment for 3 months -2.000 0.000
primary pancreatic ductal adenocarcinoma 1.713 0.011
ulcerative colitis 3.400 0.000
breast carcinoma -1.500 0.002
fibroadenoma -1.800 0.028
diabetes mellitus -1.800 0.033
lung carcinoma -2.400 0.000
gastric carcinoma 1.600 0.010
Bipolar Disorder 1.122 0.039
mucosa-associated lymphoid tissue lympho... 1.624 0.035
ductal carcinoma in situ -2.800 0.000
invasive ductal carcinoma -2.300 0.003
ovarian cancer 1.500 0.003
pituitary cancer -1.200 0.000
pancreatic cancer 1.800 0.003
dermatomyositis 2.200 0.003

 MGI Term (1)

Gene RIF (42)

PMID Text
27491149 The expression of PFKFB3, PFKFB4, NAMPT, and TSPAN13 is strongly up-regulated in pediatric glioma.
26827442 Insulin resistance in obese boys leads to up-regulation of INSIG2 gene expression as well as to down-regulation of PFKFB1, PFKFB3, and HK2 genes in the blood cells as compared to obese patients with normal insulin sensitivity.
26718307 a novel role of PFKFB3 in glycolytic metabolism and ER stress of OA cartilage explants and chondrocytes
26681033 MicroRNA-26b inhibits osteosarcoma cell migration and invasion by down-regulating PFKFB3 expression
26530697 Our data suggest that chronic inflammation promotes the development of CRC by stimulating aerobic glycolysis and IL-6 is functioning, at least partly, through regulating PFKFB3 at early stage of colorectal cancer (CRC).
26337471 Data indicate that 6-phosphofructo-2-kinase/fructose-2,6-biphosphatase3 (PFKFB3) and phosphofructokinase (PFK1) expression allows discrimination between induced pluripotent stem cells (iPS) and cancer stem cells (CSCs).
26322680 Data show that inhibition of AMP-Activated kinase (AMPK) or 6-phosphofructo-2-kinase-fructose-2,6-biphosphatase 3 (PFKFB3) results in enhanced cell death in mitosis.
26171876 Shh regulates PFKFB3 activation in breast cancer cells.
26093295 study demonstrated that miR-206 regulated PFKFB3 expression in breast cancer cells, thereby stunting glycolysis, cell proliferation and migration
25672572 A binding site for miR-26b was predicted in the 3'UTR of PFKFB3. miR-26b overexpression repressed PFKFB3 mRNA and protein levels.
More...

AA Sequence

MPLELTQSRVQKIWVPVDHRPSLPRSCGPKLTNSPTVIVMVGLPARGKTYISKKLTRYLNWIGVPTKVFN      1 - 70
VGEYRREAVKQYSSYNFFRPDNEEAMKVRKQCALAALRDVKSYLAKEGGQIAVFDATNTTRERRHMILHF     71 - 140
AKENDFKAFFIESVCDDPTVVASNIMEVKISSPDYKDCNSAEAMDDFMKRISCYEASYQPLDPDKCDRDL    141 - 210
SLIKVIDVGRRFLVNRVQDHIQSRIVYYLMNIHVQPRTIYLCRHGENEHNLQGRIGGDSGLSSRGKKFAS    211 - 280
ALSKFVEEQNLKDLRVWTSQLKSTIQTAEALRLPYEQWKALNEIDAGVCEELTYEEIRDTYPEEYALREQ    281 - 350
DKYYYRYPTGESYQDLVQRLEPVIMELERQENVLVICHQAVLRCLLAYFLDKSAEEMPYLKCPLHTVLKL    351 - 420
TPVAYGCRVESIYLNVESVCTHRERSEDAKKGPNPLMRRNSVTPLASPEPTKKPRINSFEEHVASTSAAL    421 - 490
PSCLPPEVPTQLPGQNMKGSRSSADSSRKH                                            491 - 520
//

Text Mined References (73)

PMID Year Title
27491149 [EXPRESSION OF PFKFB, HK2, NAMPT, TSPAN13 AND HSPB8 GENES IN PEDIATRIC GLIOMA].
26827442 [EXPRESSION OF GENES, WHICH CONTROL GLUCOSE METABOLISM, IN BLOOD CELLS OF THE OBESE BOYS WITH INSULIN RESISTANCE].
26718307 2016 PFKFB3 modulates glycolytic metabolism and alleviates endoplasmic reticulum stress in human osteoarthritis cartilage.
26681033 2015 MicroRNA-26b inhibits osteosarcoma cell migration and invasion by down-regulating PFKFB3 expression.
26530697 2016 Interleukin-6 stimulates aerobic glycolysis by regulating PFKFB3 at early stage of colorectal cancer.
26337471 2015 The expression pattern of PFKFB3 enzyme distinguishes between induced-pluripotent stem cells and cancer stem cells.
26322680 2015 AMPK and PFKFB3 mediate glycolysis and survival in response to mitophagy during mitotic arrest.
26171876 2015 Sonic hedgehog stimulates glycolysis and proliferation of breast cancer cells: Modulation of PFKFB3 activation.
26093295 2015 Overexpression of miR-206 suppresses glycolysis, proliferation and migration in breast cancer cells via PFKFB3 targeting.
25849762 2015 Structure-Based Design of Potent and Selective Inhibitors of the Metabolic Kinase PFKFB3.
More...