Property Summary

Ligand Count 9
NCBI Gene PubMed Count 76
PubMed Score 205.96
PubTator Score 126.71

Knowledge Summary

Patent (10,885)

TINX Plot

  Disease (6)

Expression

  Differential Expression (26)

Disease log2 FC p
Bipolar Disorder 1.122 3.9e-02
active ulcerative colitis 1.279 1.7e-02
acute quadriplegic myopathy 1.440 1.3e-02
astrocytoma 2.400 5.6e-03
atypical teratoid / rhabdoid tumor -1.100 6.1e-03
breast carcinoma -1.500 1.6e-03
dermatomyositis 2.200 2.6e-03
diabetes mellitus -1.800 3.3e-02
ductal carcinoma in situ -2.800 5.5e-05
fibroadenoma -1.800 2.8e-02
gastric carcinoma 1.600 9.8e-03
glioblastoma 1.200 2.6e-02
group 3 medulloblastoma -1.600 3.4e-03
invasive ductal carcinoma -2.300 2.6e-03
lung carcinoma -2.400 9.0e-30
medulloblastoma, large-cell -2.100 7.3e-05
mucosa-associated lymphoid tissue lympho... 1.624 3.5e-02
osteosarcoma -2.208 1.4e-03
ovarian cancer 1.500 3.3e-03
pancreatic cancer 1.800 2.8e-03
pituitary cancer -1.200 3.8e-04
primary pancreatic ductal adenocarcinoma 1.713 1.1e-02
psoriasis -1.600 1.1e-04
Rheumatoid arthritis 1.300 3.2e-02
tuberculosis -1.900 4.2e-03
type 2 diabetes -1.208 4.3e-02

Protein-protein Interaction (3)

PDB (18)

Gene RIF (52)

AA Sequence

MPLELTQSRVQKIWVPVDHRPSLPRSCGPKLTNSPTVIVMVGLPARGKTYISKKLTRYLNWIGVPTKVFN      1 - 70
VGEYRREAVKQYSSYNFFRPDNEEAMKVRKQCALAALRDVKSYLAKEGGQIAVFDATNTTRERRHMILHF     71 - 140
AKENDFKAFFIESVCDDPTVVASNIMEVKISSPDYKDCNSAEAMDDFMKRISCYEASYQPLDPDKCDRDL    141 - 210
SLIKVIDVGRRFLVNRVQDHIQSRIVYYLMNIHVQPRTIYLCRHGENEHNLQGRIGGDSGLSSRGKKFAS    211 - 280
ALSKFVEEQNLKDLRVWTSQLKSTIQTAEALRLPYEQWKALNEIDAGVCEELTYEEIRDTYPEEYALREQ    281 - 350
DKYYYRYPTGESYQDLVQRLEPVIMELERQENVLVICHQAVLRCLLAYFLDKSAEEMPYLKCPLHTVLKL    351 - 420
TPVAYGCRVESIYLNVESVCTHRERSEDAKKGPNPLMRRNSVTPLASPEPTKKPRINSFEEHVASTSAAL    421 - 490
PSCLPPEVPTQLPGQNMKGSRSSADSSRKH                                            491 - 520
//

Text Mined References (83)

PMID Year Title