Property Summary

NCBI Gene PubMed Count 87
Grant Count 58
R01 Count 34
Funding $7,163,249.79
PubMed Score 91.33
PubTator Score 210.30

Knowledge Summary

Patent

No data available

Synonym

Gene

PANTHER Protein Class (1)

PDB

4WAB   2PNO   2UUH   2UUI   3B29   3HKK   3LEO   3PCV   4J7T   4J7Y   4JC7   4JCZ   4JRZ   5HV9  

Gene RIF (80)

PMID Text
24366866 Biochemical and structural characterization of LTC4S mutants along with crystal structures of the wild type and mutated enzymes in complex with three product analogs, provide new insights to binding of substrates and product.
23889244 Elevated levels of leukotriene C4 synthase mRNA distinguish a subpopulation of eosinophilic oesophagitis patients.
23828562 The results of our study failed to confirm whether the selected variants in LTC4S gene within the LT metabolism pathway contribute to platelet reactivity in a diabetic population treated with ASA.
23079278 genetic association studies in population of Han Chinese in Eastern China: Data suggest that an SNP in LTC4S (rs730012) is associated with risk of ischemic stroke; carriers of C allele of rs730012 in LTC4S are most susceptible to ischemic stroke.
22884858 meta-analysis suggested that the -444A/C polymorphism in the LTC4S gene would be a risk factor for asthma in Caucasians and aspirin-tolerant populations
22722751 A significant association has been found between the -1072G/A (rs3776944) SNP in the LTC4S gene and atopic asthma in the family-based analysis.
22217203 investigation of catalytic mechanism of LTC4S: Data suggest that glutathione thiolate anion formation in LTC4S is not rate-limiting for overall reaction of leukotriene C4 production. Thiolate anion is stabilized by Arg104 at all three active sites.
21729626 The SNPs of ALOX(5)AP and LTC(4)S are associated with asthma.
21454538 The catalytic architecture of leukotriene C4 synthase with two arginine residues.
21307858 Polymorphisms of the PTGDR and LTC4S influence responsiveness to leukotriene receptor antagonists in Korean children with asthma.
More...

AA Sequence

MKDEVALLAAVTLLGVLLQAYFSLQVISARRAFRVSPPLTTGPPEFERVYRAQVNCSEYFPLFLATLWVA      1 - 70
GIFFHEGAAALCGLVYLFARLRYFQGYARSAQLRLAPLYASARALWLLVALAALGLLAHFLPAALRAALL     71 - 140
GRLRTLLPWA                                                                141 - 150
//

Text Mined References (91)

PMID Year Title
24366866 2014 Crystal structures of leukotriene C4 synthase in complex with product analogs: implications for the enzyme mechanism.
23889244 2013 Elevated levels of leukotriene C4 synthase mRNA distinguish a subpopulation of eosinophilic oesophagitis patients.
23828562 2013 Lack of effect of common single nucleotide polymorphisms in leukotriene pathway genes on platelet reactivity in patients with diabetes.
23079278 2012 Genetic variation in members of the leukotrienes biosynthesis pathway confers risk of ischemic stroke in Eastern Han Chinese.
22884858 2012 The -444A/C polymorphism in the LTC4S gene and the risk of asthma: a meta-analysis.
22722751 2012 Association of the -1072G/A polymorphism in the LTC4S gene with asthma in an Indian population.
22217203 2012 Pre-steady-state kinetic characterization of thiolate anion formation in human leukotriene C? synthase.
21729626 2011 [Association of leukotriene gene polymorphisms with response to antileukotriene treatment in patients with asthma].
21454538 2011 The catalytic architecture of leukotriene C4 synthase with two arginine residues.
21307858 2011 Polymorphisms of the PTGDR and LTC4S influence responsiveness to leukotriene receptor antagonists in Korean children with asthma.
More...