Property Summary

NCBI Gene PubMed Count 88
PubMed Score 93.91
PubTator Score 210.30

Knowledge Summary

Patent

No data available

Gene RIF (81)

AA Sequence

MKDEVALLAAVTLLGVLLQAYFSLQVISARRAFRVSPPLTTGPPEFERVYRAQVNCSEYFPLFLATLWVA      1 - 70
GIFFHEGAAALCGLVYLFARLRYFQGYARSAQLRLAPLYASARALWLLVALAALGLLAHFLPAALRAALL     71 - 140
GRLRTLLPWA                                                                141 - 150
//

Text Mined References (92)

PMID Year Title