Property Summary

NCBI Gene PubMed Count 24
PubMed Score 8.62
PubTator Score 3.14

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession Q16864 C9J2K4 Q6IBA8 V-ATPase subunit F
Symbols VATF
Vma7
ATP6S14

Gene

Gene RIF (1)

PMID Text
19723111 Results show that NiK-12192, by affecting vacuolar- H(+)-ATPase activity (and intracellular pH), causes a modification of structures crucial for cell adhesion and induces cell death, likely by a modality involving an anoikis-mediated apoptosis.

AA Sequence

MAGRGKLIAVIGDEDTVTGFLLGGIGELNKNRHPNFLVVEKDTTINEIEDTFRQFLNRDDIGIILINQYI      1 - 70
AEMVRHALDAHQQSIPAVLEIPSKEHPYDAAKDSILRRARGMFTAEDLR                          71 - 119
//

Text Mined References (27)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
21269460 2011 Initial characterization of the human central proteome.
19723111 2009 Biological effects of a new vacuolar-H,-ATPase inhibitor in colon carcinoma cell lines.
19199708 2009 Proteomic analysis of human parotid gland exosomes by multidimensional protein identification technology (MudPIT).
19056867 2009 Large-scale proteomics and phosphoproteomics of urinary exosomes.
18752060 2008 The d subunit plays a central role in human vacuolar H(+)-ATPases.
17662945 2007 Coupling of rotation and catalysis in F(1)-ATPase revealed by single-molecule imaging and manipulation.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14597263 2003 Neurotransmitter release: the dark side of the vacuolar-H+ATPase.
More...