Property Summary

NCBI Gene PubMed Count 24
PubMed Score 8.62
PubTator Score 3.14

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession Q16864 C9J2K4 Q6IBA8 V-ATPase subunit F
Symbols VATF
Vma7
ATP6S14

Gene

  Ortholog (10)

Species Source
Mouse OMA EggNOG Inparanoid
Rat OMA Inparanoid
Dog OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Pig OMA EggNOG
Opossum OMA EggNOG
Platypus OMA EggNOG Inparanoid
Xenopus OMA EggNOG Inparanoid
C. elegans OMA Inparanoid
S.cerevisiae OMA EggNOG Inparanoid

 GWAS Trait (1)

Gene RIF (1)

PMID Text
19723111 Results show that NiK-12192, by affecting vacuolar- H(+)-ATPase activity (and intracellular pH), causes a modification of structures crucial for cell adhesion and induces cell death, likely by a modality involving an anoikis-mediated apoptosis.

AA Sequence

MAGRGKLIAVIGDEDTVTGFLLGGIGELNKNRHPNFLVVEKDTTINEIEDTFRQFLNRDDIGIILINQYI      1 - 70
AEMVRHALDAHQQSIPAVLEIPSKEHPYDAAKDSILRRARGMFTAEDLR                          71 - 119
//

Text Mined References (27)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
21269460 2011 Initial characterization of the human central proteome.
19723111 2009 Biological effects of a new vacuolar-H,-ATPase inhibitor in colon carcinoma cell lines.
19199708 2009 Proteomic analysis of human parotid gland exosomes by multidimensional protein identification technology (MudPIT).
19056867 2009 Large-scale proteomics and phosphoproteomics of urinary exosomes.
18752060 2008 The d subunit plays a central role in human vacuolar H(+)-ATPases.
17662945 2007 Coupling of rotation and catalysis in F(1)-ATPase revealed by single-molecule imaging and manipulation.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14597263 2003 Neurotransmitter release: the dark side of the vacuolar-H+ATPase.
More...