Property Summary

NCBI Gene PubMed Count 40
PubMed Score 82.46
PubTator Score 64.14

Knowledge Summary

Patent (6,384)

TINX Plot

  Disease (5)

Disease Target Count P-value
malignant mesothelioma 3232 4.8e-06
ovarian cancer 8520 2.9e-05
tuberculosis and treatment for 6 months 409 1.2e-03
lung cancer 4740 5.7e-03
Disease Target Count Z-score Confidence
Chronic progressive external ophthalmoplegia 26 0.0 4.0
Neuropathy 261 0.0 4.0

Expression

  Differential Expression (4)

Disease log2 FC p
lung cancer 1.400 5.7e-03
malignant mesothelioma 1.100 4.8e-06
ovarian cancer 1.200 2.9e-05
tuberculosis and treatment for 6 months -1.200 1.2e-03

Gene RIF (20)

AA Sequence

MAAGRLFLSRLRAPFSSMAKSPLEGVSSSRGLHAGRGPRRLSIEGNIAVGKSTFVKLLTKTYPEWHVATE      1 - 70
PVATWQNIQAAGTQKACTAQSLGNLLDMMYREPARWSYTFQTFSFLSRLKVQLEPFPEKLLQARKPVQIF     71 - 140
ERSVYSDRYIFAKNLFENGSLSDIEWHIYQDWHSFLLWEFASRITLHGFIYLQASPQVCLKRLYQRAREE    141 - 210
EKGIELAYLEQLHGQHEAWLIHKTTKLHFEALMNIPVLVLDVNDDFSEEVTKQEDLMREVNTFVKNL       211 - 277
//

Text Mined References (42)

PMID Year Title