Property Summary

NCBI Gene PubMed Count 75
Grant Count 72
R01 Count 48
Funding $10,749,790.12
PubMed Score 649.06
PubTator Score 216.79

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession Q16853 B2RCI5 K7ESB3 L0L8N9 Q45F94
Symbols HPAO
SSAO
VAP1
VAP-1

Gene

PDB

1PU4   1US1   2C10   2C11   2Y73   2Y74   3ALA   4BTW   4BTX   4BTY  

Gene RIF (61)

PMID Text
26845338 serum VAP-1 can predict ESRD and is a useful biomarker to improve risk stratification in type 2 diabetic subjects.
26287391 In this article, we will review the general characteristics and biological functions of VAP-1, focusing on its important role as a prognostic biomarker in human pathologies. [review]
25562318 these results link the amine oxidase activity of VAP-1 with hepatic inflammation and fibrosis and suggest that targeting VAP-1 has therapeutic potential for NAFLD and other chronic fibrotic liver diseases.
25457560 It stimulates amyloid beta proteins on the vascular walls, and is contributing to cerebral amyloid angiopathies and Alzheimer disease.
25420878 Complexes of human ORP2 and VAPs at endoplasmic reticulum-lipid droplet interfaces regulate the hydrolysis of triglycerides and lipid droplet turnover.
25342050 the semicarbazide-sensitive amine oxidase activity of VAP-1 modifies hepatic glucose homeostasis and may contribute to patterns of GLUT expression in chronic disease.
24903765 This study demonstrated that low serum VAP-1 levels are associated with poor prognosis in gastric cancer patients.
24781952 Higher serum VAP-1 and Chronic kidney disease can independently predict future development of cancers in type II diabetic subjects
24503888 SSAO expression in endothelial cells increases oxygen-glucose-deprivation-associated cell damage. It mediates some tissue damage during the reoxygenation process by oxidizing its known enzymatic substrate, methylamine.
24379274 We concluded that VAP-1, elevated in patients on Peritoneal Dialysis, was predominantly dependent on residual kidney function and glucose level, factors both linked to endothelial damage and cardiovascular complications.
More...

AA Sequence

MNQKTILVLLILAVITIFALVCVLLVGRGGDGGEPSQLPHCPSVSPSAQPWTHPGQSQLFADLSREELTA      1 - 70
VMRFLTQRLGPGLVDAAQARPSDNCVFSVELQLPPKAAALAHLDRGSPPPAREALAIVFFGRQPQPNVSE     71 - 140
LVVGPLPHPSYMRDVTVERHGGPLPYHRRPVLFQEYLDIDQMIFNRELPQASGLLHHCCFYKHRGRNLVT    141 - 210
MTTAPRGLQSGDRATWFGLYYNISGAGFFLHHVGLELLVNHKALDPARWTIQKVFYQGRYYDSLAQLEAQ    211 - 280
FEAGLVNVVLIPDNGTGGSWSLKSPVPPGPAPPLQFYPQGPRFSVQGSRVASSLWTFSFGLGAFSGPRIF    281 - 350
DVRFQGERLVYEISLQEALAIYGGNSPAAMTTRYVDGGFGMGKYTTPLTRGVDCPYLATYVDWHFLLESQ    351 - 420
APKTIRDAFCVFEQNQGLPLRRHHSDLYSHYFGGLAETVLVVRSMSTLLNYDYVWDTVFHPSGAIEIRFY    421 - 490
ATGYISSAFLFGATGKYGNQVSEHTLGTVHTHSAHFKVDLDVAGLENWVWAEDMVFVPMAVPWSPEHQLQ    491 - 560
RLQVTRKLLEMEEQAAFLVGSATPRYLYLASNHSNKWGHPRGYRIQMLSFAGEPLPQNSSMARGFSWERY    561 - 630
QLAVTQRKEEEPSSSSVFNQNDPWAPTVDFSDFINNETIAGKDLVAWVTAGFLHIPHAEDIPNTVTVGNG    631 - 700
VGFFLRPYNFFDEDPSFYSADSIYFRGDQDAGACEVNPLACLPQAAACAPDLPAFSHGGFSHN           701 - 763
//

Text Mined References (80)

PMID Year Title
26845338 2016 Serum Vascular Adhesion Protein-1 Predicts End-Stage Renal Disease in Patients with Type 2 Diabetes.
26287391 2015 Vascular adhesion protein-1: Role in human pathology and application as a biomarker.
25562318 2015 Vascular adhesion protein-1 promotes liver inflammation and drives hepatic fibrosis.
25457560 2015 Cross-talk between A? and endothelial SSAO/VAP-1 accelerates vascular damage and A? aggregation related to CAA-AD.
25420878 2015 Ligand-dependent localization and function of ORP-VAP complexes at membrane contact sites.
25342050 2014 Dysregulated hepatic expression of glucose transporters in chronic disease: contribution of semicarbazide-sensitive amine oxidase to hepatic glucose uptake.
24903765 2014 Relationship between serum soluble vascular adhesion protein-1 level and gastric cancer prognosis.
24781952 2014 Serum vascular adhesion protein-1 level predicts risk of incident cancers in subjects with type II diabetes.
24503888 2014 Involvement of SSAO/VAP-1 in oxygen-glucose deprivation-mediated damage using the endothelial hSSAO/VAP-1-expressing cells as experimental model of cerebral ischemia.
24379274 2013 VAP-1 in peritoneally dialyzed patients.
More...