Property Summary

NCBI Gene PubMed Count 24
PubMed Score 342.45
PubTator Score 84.88

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (22)

Disease log2 FC p
astrocytic glioma -1.900 8.0e-03
atypical teratoid / rhabdoid tumor -1.100 2.2e-04
colon cancer -1.500 1.2e-04
ductal carcinoma in situ -1.300 8.2e-04
gastric cancer 1.300 1.9e-03
glioblastoma -1.100 1.8e-02
group 4 medulloblastoma -1.100 7.3e-04
hepatocellular carcinoma 1.400 6.8e-05
invasive ductal carcinoma -1.400 3.4e-03
medulloblastoma, large-cell -2.300 6.2e-07
Multiple myeloma 1.425 1.9e-03
oligodendroglioma -1.600 3.0e-02
osteosarcoma -1.219 4.1e-05
ovarian cancer -3.400 1.7e-11
pancreatic cancer 1.200 5.3e-03
pancreatic carcinoma 1.200 5.3e-03
pancreatic ductal adenocarcinoma liver m... -2.226 4.0e-03
primitive neuroectodermal tumor -1.200 1.1e-04
psoriasis 1.400 4.1e-04
tuberculosis -1.700 5.3e-04
ulcerative colitis -1.200 1.6e-06
Waldenstrons macroglobulinemia 1.617 1.3e-03

 GWAS Trait (1)

Protein-protein Interaction (2)

Gene RIF (4)

AA Sequence

MSRFVQDLSKAMSQDGASQFQEVIRQELELSVKKELEKILTTASSHEFEHTKKDLDGFRKLFHRFLQEKG      1 - 70
PSVDWGKIQRPPEDSIQPYEKIKARGLPDNISSVLNKLVVVKLNGGLGTSMGCKGPKSLIGVRNENTFLD     71 - 140
LTVQQIEHLNKTYNTDVPLVLMNSFNTDEDTKKILQKYNHCRVKIYTFNQSRYPRINKESLLPVAKDVSY    141 - 210
SGENTEAWYPPGHGDIYASFYNSGLLDTFIGEGKEYIFVSNIDNLGATVDLYILNHLMNPPNGKRCEFVM    211 - 280
EVTNKTRADVKGGTLTQYEGKLRLVEIAQVPKAHVDEFKSVSKFKIFNTNNLWISLAAVKRLQEQNAIDM    281 - 350
EIIVNAKTLDGGLNVIQLETAVGAAIKSFENSLGINVPRSRFLPVKTTSDLLLVMSNLYSLNAGSLTMSE    351 - 420
KREFPTVPLVKLGSSFTKVQDYLRRFESIPDMLELDHLTVSGDVTFGKNVSLKGTVIIIANHGDRIDIPP    421 - 490
GAVLENKIVSGNLRILDH                                                        491 - 508
//

Text Mined References (33)

PMID Year Title