Property Summary

NCBI Gene PubMed Count 24
Grant Count 19
R01 Count 14
Funding $1,044,049.82
PubMed Score 337.92
PubTator Score 84.88

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (22)

Disease log2 FC p
gastric cancer 1.300 0.002
hepatocellular carcinoma 1.400 0.000
pancreatic cancer 1.200 0.005
Waldenstrons macroglobulinemia 1.617 0.001
Multiple myeloma 1.425 0.002
astrocytoma -2.100 0.001
oligodendroglioma -1.600 0.030
psoriasis 1.400 0.000
osteosarcoma -1.219 0.000
glioblastoma -1.100 0.018
atypical teratoid / rhabdoid tumor -1.100 0.000
medulloblastoma -1.400 0.000
medulloblastoma, large-cell -2.300 0.000
primitive neuroectodermal tumor -1.200 0.000
tuberculosis -1.700 0.001
pancreatic ductal adenocarcinoma liver m... -2.226 0.004
colon cancer -1.500 0.000
pancreatic carcinoma 1.200 0.005
ductal carcinoma in situ -1.300 0.001
invasive ductal carcinoma -1.400 0.003
ulcerative colitis -1.200 0.000
ovarian cancer -3.400 0.000

Gene RIF (4)

PMID Text
23254995 This study provides clear evidence that the octameric state is a prerequisite for activity in the uridine diphosphate-glucose pyrophosphorylase.
22132858 The crystal structure was determined and shown to form octamers through end-to-end and side-by-side interactions. Mutagenesis studies showed that both dissociation of octamers and mutations of the latch loop can significantly affect the activity.
20514852 Observational study of gene-disease association. (HuGE Navigator)
20300197 GYS1 regulation by HIF plays a central role in the hypoxic accumulation of glycogen, and hypoxia also upregulates the expression of UTP:glucose-1-phosphate urydylyltransferase (UGP2) and 1,4-alpha glucan branching enzyme (GBE1)

AA Sequence

MSRFVQDLSKAMSQDGASQFQEVIRQELELSVKKELEKILTTASSHEFEHTKKDLDGFRKLFHRFLQEKG      1 - 70
PSVDWGKIQRPPEDSIQPYEKIKARGLPDNISSVLNKLVVVKLNGGLGTSMGCKGPKSLIGVRNENTFLD     71 - 140
LTVQQIEHLNKTYNTDVPLVLMNSFNTDEDTKKILQKYNHCRVKIYTFNQSRYPRINKESLLPVAKDVSY    141 - 210
SGENTEAWYPPGHGDIYASFYNSGLLDTFIGEGKEYIFVSNIDNLGATVDLYILNHLMNPPNGKRCEFVM    211 - 280
EVTNKTRADVKGGTLTQYEGKLRLVEIAQVPKAHVDEFKSVSKFKIFNTNNLWISLAAVKRLQEQNAIDM    281 - 350
EIIVNAKTLDGGLNVIQLETAVGAAIKSFENSLGINVPRSRFLPVKTTSDLLLVMSNLYSLNAGSLTMSE    351 - 420
KREFPTVPLVKLGSSFTKVQDYLRRFESIPDMLELDHLTVSGDVTFGKNVSLKGTVIIIANHGDRIDIPP    421 - 490
GAVLENKIVSGNLRILDH                                                        491 - 508
//

Text Mined References (33)

PMID Year Title
25860585 2015 A quaternary mechanism enables the complex biological functions of octameric human UDP-glucose pyrophosphorylase, a key enzyme in cell metabolism.
25416956 2014 A proteome-scale map of the human interactome network.
25187353 2014 Clozapine-induced agranulocytosis is associated with rare HLA-DQB1 and HLA-B alleles.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23254995 2013 Octamerization is essential for enzymatic function of human UDP-glucose pyrophosphorylase.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22223895 2012 Comparative large scale characterization of plant versus mammal proteins reveals similar and idiosyncratic N-?-acetylation features.
More...