Property Summary

NCBI Gene PubMed Count 24
PubMed Score 337.92
PubTator Score 84.88

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
ovarian cancer 8492 1.71839160776736E-11
medulloblastoma, large-cell 6234 6.15183169537107E-7
medulloblastoma 1524 1.16797848971475E-6
ulcerative colitis 2087 1.63625688129268E-6
osteosarcoma 7933 4.13004730068194E-5
hepatocellular carcinoma 550 6.75969395074758E-5
primitive neuroectodermal tumor 3031 1.06033108055518E-4
colon cancer 1475 1.23421260206699E-4
atypical teratoid / rhabdoid tumor 4369 2.24176444974362E-4
psoriasis 6685 4.14780285748029E-4
tuberculosis 1563 5.3268648448227E-4
ductal carcinoma in situ 1745 8.15874013187432E-4
astrocytoma 1493 0.00126731437012653
Waldenstrons macroglobulinemia 765 0.00133139665441034
Multiple myeloma 1328 0.00186491636477947
gastric cancer 436 0.00187327931117488
invasive ductal carcinoma 2950 0.00342082537069211
pancreatic ductal adenocarcinoma liver metastasis 1795 0.00397816946698161
pancreatic cancer 2300 0.00527184385897031
pancreatic carcinoma 567 0.00527184385897046
glioblastoma 5572 0.0183623219878931
oligodendroglioma 2849 0.0298101688508236

Expression

  Differential Expression (22)

Disease log2 FC p
gastric cancer 1.300 0.002
hepatocellular carcinoma 1.400 0.000
pancreatic cancer 1.200 0.005
Waldenstrons macroglobulinemia 1.617 0.001
Multiple myeloma 1.425 0.002
astrocytoma -2.100 0.001
oligodendroglioma -1.600 0.030
psoriasis 1.400 0.000
osteosarcoma -1.219 0.000
glioblastoma -1.100 0.018
atypical teratoid / rhabdoid tumor -1.100 0.000
medulloblastoma -1.400 0.000
medulloblastoma, large-cell -2.300 0.000
primitive neuroectodermal tumor -1.200 0.000
tuberculosis -1.700 0.001
pancreatic ductal adenocarcinoma liver m... -2.226 0.004
colon cancer -1.500 0.000
pancreatic carcinoma 1.200 0.005
ductal carcinoma in situ -1.300 0.001
invasive ductal carcinoma -1.400 0.003
ulcerative colitis -1.200 0.000
ovarian cancer -3.400 0.000

Synonym

Accession Q16851 Q07131 Q0P6K2 Q86Y81 Q9BU15
Symbols UDPG
UGP1
UDPGP
UGPP1
UGPP2
UDPGP2
pHC379

Gene

PDB

3R2W   3R3I   4R7P  

  Ortholog (16)

Gene RIF (4)

PMID Text
23254995 This study provides clear evidence that the octameric state is a prerequisite for activity in the uridine diphosphate-glucose pyrophosphorylase.
22132858 The crystal structure was determined and shown to form octamers through end-to-end and side-by-side interactions. Mutagenesis studies showed that both dissociation of octamers and mutations of the latch loop can significantly affect the activity.
20514852 Observational study of gene-disease association. (HuGE Navigator)
20300197 GYS1 regulation by HIF plays a central role in the hypoxic accumulation of glycogen, and hypoxia also upregulates the expression of UTP:glucose-1-phosphate urydylyltransferase (UGP2) and 1,4-alpha glucan branching enzyme (GBE1)

AA Sequence

MSRFVQDLSKAMSQDGASQFQEVIRQELELSVKKELEKILTTASSHEFEHTKKDLDGFRKLFHRFLQEKG      1 - 70
PSVDWGKIQRPPEDSIQPYEKIKARGLPDNISSVLNKLVVVKLNGGLGTSMGCKGPKSLIGVRNENTFLD     71 - 140
LTVQQIEHLNKTYNTDVPLVLMNSFNTDEDTKKILQKYNHCRVKIYTFNQSRYPRINKESLLPVAKDVSY    141 - 210
SGENTEAWYPPGHGDIYASFYNSGLLDTFIGEGKEYIFVSNIDNLGATVDLYILNHLMNPPNGKRCEFVM    211 - 280
EVTNKTRADVKGGTLTQYEGKLRLVEIAQVPKAHVDEFKSVSKFKIFNTNNLWISLAAVKRLQEQNAIDM    281 - 350
EIIVNAKTLDGGLNVIQLETAVGAAIKSFENSLGINVPRSRFLPVKTTSDLLLVMSNLYSLNAGSLTMSE    351 - 420
KREFPTVPLVKLGSSFTKVQDYLRRFESIPDMLELDHLTVSGDVTFGKNVSLKGTVIIIANHGDRIDIPP    421 - 490
GAVLENKIVSGNLRILDH                                                        491 - 508
//

Text Mined References (33)

PMID Year Title
25860585 2015 A quaternary mechanism enables the complex biological functions of octameric human UDP-glucose pyrophosphorylase, a key enzyme in cell metabolism.
25416956 2014 A proteome-scale map of the human interactome network.
25187353 2014 Clozapine-induced agranulocytosis is associated with rare HLA-DQB1 and HLA-B alleles.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23254995 2013 Octamerization is essential for enzymatic function of human UDP-glucose pyrophosphorylase.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22223895 2012 Comparative large scale characterization of plant versus mammal proteins reveals similar and idiosyncratic N-?-acetylation features.
More...