Property Summary

NCBI Gene PubMed Count 28
Grant Count 80
R01 Count 50
Funding $16,902,425.17
PubMed Score 592.72
PubTator Score 173.40

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession Q16850 A4D1F8 B2RAI4 B4DJ55 O00770 O00772 Q16784 Q8N1A8 Q99868 LDM
Symbols LDM
CP51
CYP51
CYPL1
P450L1
P450-14DM

Gene

PDB

3JUS   3JUV   3LD6   4UHI   4UHL  

 GWAS Trait (1)

Gene RIF (14)

PMID Text
26002733 Acyl-Carbon Bond Cleaving Cytochrome P450 Enzymes: CYP17A1, CYP19A1 and CYP51A1.
24711211 Suggest that GDF9, possibly with FSH, may play significant roles in the regulation of cholesterol biosynthesis and the expression of CYP51A1 in granulosa cells which might be a predictor for unfertilization.
24502137 The studied azoles selectively interacted with human cytochrome P450 51A1, which showed the highest affinity towards ketoconazole.
24362992 Low nucleotide variability of CYP51A1 is seen in cholesterol and bile acid synthesis and xenobiotic metabolism pathways.
24358204 Our results indicate a new link between a cholesterol synthesis gene CYP51A1 and pregnancy pathologies.
24353279 Data show that forkhead transcription factor 4 (FoxO4) interacts with sterol regulatory element binding protein (SREBP)2 and hypoxia inducible factor (HIF)2alpha to modulate lanosterol 14alpha demethylase (CYP51) promoter activity.
22180046 The new CYP51A1 inhibitor 2-((3,4-dichlorophenethyl)(propyl)amino)-1-(pyridin-3-yl)ethanol (LEK-935) on the proteome of primary human hepatocytes were analyzed.
20547249 Studies indicate that CPY51 structures from various eukaryotic organisms are strikingly similar.
20149798 The substantial conformational changes in the B' helix and F-G loop regions are induced upon ligand binding, consistent with the membrane nature of the protein and its substrate.
18676367 the liver X receptor alpha directly silencing the expression of two key cholesterologenic enzymes (lanosterol 14alpha-demethylase (CYP51A1), and squalene synthase (farnesyl diphosphate farnesyl transferase 1)) via novel negative LXR DNA response elements
More...

AA Sequence

MLLLGLLQAGGSVLGQAMEKVTGGNLLSMLLIACAFTLSLVYLIRLAAGHLVQLPAGVKSPPYIFSPIPF      1 - 70
LGHAIAFGKSPIEFLENAYEKYGPVFSFTMVGKTFTYLLGSDAAALLFNSKNEDLNAEDVYSRLTTPVFG     71 - 140
KGVAYDVPNPVFLEQKKMLKSGLNIAHFKQHVSIIEKETKEYFESWGESGEKNVFEALSELIILTASHCL    141 - 210
HGKEIRSQLNEKVAQLYADLDGGFSHAAWLLPGWLPLPSFRRRDRAHREIKDIFYKAIQKRRQSQEKIDD    211 - 280
ILQTLLDATYKDGRPLTDDEVAGMLIGLLLAGQHTSSTTSAWMGFFLARDKTLQKKCYLEQKTVCGENLP    281 - 350
PLTYDQLKDLNLLDRCIKETLRLRPPIMIMMRMARTPQTVAGYTIPPGHQVCVSPTVNQRLKDSWVERLD    351 - 420
FNPDRYLQDNPASGEKFAYVPFGAGRHRCIGENFAYVQIKTIWSTMLRLYEFDLIDGYFPTVNYTTMIHT    421 - 490
PENPVIRYKRRSK                                                             491 - 503
//

Text Mined References (31)

PMID Year Title
26002733 2015 Acyl-Carbon Bond Cleaving Cytochrome P450 Enzymes: CYP17A1, CYP19A1 and CYP51A1.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
24711211 2015 CYP51A1 induced by growth differentiation factor 9 and follicle-stimulating hormone in granulosa cells is a possible predictor for unfertilization.
24502137 [SPR-biosensor assay for analysis of small compounds interaction with human cytochrome P450 51A1 (CYP51A1)].
24362992 2013 Low nucleotide variability of CYP51A1 in humans: meta-analysis of cholesterol and bile acid synthesis and xenobiotic metabolism pathways.
24358204 2013 Polymorphisms of CYP51A1 from cholesterol synthesis: associations with birth weight and maternal lipid levels and impact on CYP51 protein structure.
24353279 2014 FoxO4 interacts with the sterol regulatory factor SREBP2 and the hypoxia inducible factor HIF2? at the CYP51 promoter.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
22180046 2012 The effects of rosuvastatin and the CYP51A1 inhibitor LEK-935 on the proteome of primary human hepatocytes.
21269460 2011 Initial characterization of the human central proteome.
More...