Property Summary

NCBI Gene PubMed Count 47
Grant Count 187
R01 Count 96
Funding $26,224,223.72
PubMed Score 723.80
PubTator Score 600.25

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Disease log2 FC p
malignant mesothelioma 1.800 0.000
ependymoma -2.500 0.000
astrocytoma -2.000 0.000
glioblastoma multiforme -2.000 0.000
oligodendroglioma -1.700 0.000
atypical teratoid/rhabdoid tumor -2.300 0.000
pediatric high grade glioma -1.400 0.006
pilocytic astrocytoma -2.200 0.000
sonic hedgehog group medulloblastoma -1.300 0.021
lung carcinoma 3.500 0.000
Pick disease -1.200 0.016

Synonym

Accession Q16849 B4DK12 F5GZS3 Q08319 Q53QD6 Q6NSL1 R-PTP-N
Symbols IA2
IA-2
ICA512
R-PTP-N
IA-2/PTP

Gene

PDB

2I1Y   2QT7   3N01   3N4W   3NG8   3NP5  

Gene RIF (30)

PMID Text
26836020 RESP18HD is required for efficient sorting of ICA512 to secretory granules: RESP18HD is a key determinant for ICA512 granule targeting.
26564179 Identification of amino acids contributing to distinct epitopes on IA-2, with both HLA-DR and HLA-DQ alleles influencing epitope specificity.
25645784 Kaplan-Meier survival curves estimated a worst pancreas graft survival for patients with positive IA-2 antibodies versus those patients with negative auto-antibodies and GAD65+ auto-antibodies after simultaneous pancreas kidney transplantation.
25528004 The binding of CREB to the promoter region, -216 to +115, enhanced IA-2 transcription by more than fivefold.
23396399 Humoral responses to islet antigen-2 and zinc transporter 8 are attenuated in patients carrying HLA-A*24 alleles at the onset of type 1 diabetes.
23110943 the IA-2A autoantibody response in children is intense with rapid maturation against immunogenic epitopes and a strong association with diabetes development
22966073 identification of cysteines that are critical for IA-2A binding of autoantibodies in patients with newly diagnosed type 1 diabetes
21935384 analysis of protein-protein interactions in crystals of the human receptor-type protein tyrosine phosphatase ICA512 ectodomain
21792090 ZnT8A, GADA and IA-2A are autoantibodies that may have a role in successful pancreas graft survival
21744463 In families with type 1 diabetes, there was a female predominance and more family history of associated autoimmune diseases (AAIDs) in the group with AAIDs, and less frequent anti-IA-2 antibodies
More...

AA Sequence

MRRPRRPGGLGGSGGLRLLLCLLLLSSRPGGCSAVSAHGCLFDRRLCSHLEVCIQDGLFGQCQVGVGQAR      1 - 70
PLLQVTSPVLQRLQGVLRQLMSQGLSWHDDLTQYVISQEMERIPRLRPPEPRPRDRSGLAPKRPGPAGEL     71 - 140
LLQDIPTGSAPAAQHRLPQPPVGKGGAGASSSLSPLQAELLPPLLEHLLLPPQPPHPSLSYEPALLQPYL    141 - 210
FHQFGSRDGSRVSEGSPGMVSVGPLPKAEAPALFSRTASKGIFGDHPGHSYGDLPGPSPAQLFQDSGLLY    211 - 280
LAQELPAPSRARVPRLPEQGSSSRAEDSPEGYEKEGLGDRGEKPASPAVQPDAALQRLAAVLAGYGVELR    281 - 350
QLTPEQLSTLLTLLQLLPKGAGRNPGGVVNVGADIKKTMEGPVEGRDTAELPARTSPMPGHPTASPTSSE    351 - 420
VQQVPSPVSSEPPKAARPPVTPVLLEKKSPLGQSQPTVAGQPSARPAAEEYGYIVTDQKPLSLAAGVKLL    421 - 490
EILAEHVHMSSGSFINISVVGPALTFRIRHNEQNLSLADVTQQAGLVKSELEAQTGLQILQTGVGQREEA    491 - 560
AAVLPQTAHSTSPMRSVLLTLVALAGVAGLLVALAVALCVRQHARQQDKERLAALGPEGAHGDTTFEYQD    561 - 630
LCRQHMATKSLFNRAEGPPEPSRVSSVSSQFSDAAQASPSSHSSTPSWCEEPAQANMDISTGHMILAYME    631 - 700
DHLRNRDRLAKEWQALCAYQAEPNTCATAQGEGNIKKNRHPDFLPYDHARIKLKVESSPSRSDYINASPI    701 - 770
IEHDPRMPAYIATQGPLSHTIADFWQMVWESGCTVIVMLTPLVEDGVKQCDRYWPDEGASLYHVYEVNLV    771 - 840
SEHIWCEDFLVRSFYLKNVQTQETRTLTQFHFLSWPAEGTPASTRPLLDFRRKVNKCYRGRSCPIIVHCS    841 - 910
DGAGRTGTYILIDMVLNRMAKGVKEIDIAATLEHVRDQRPGLVRSKDQFEFALTAVAEEVNAILKALPQ     911 - 979
//

Text Mined References (56)

PMID Year Title
26836020 2016 Biochemical, biophysical, and functional properties of ICA512/IA-2 RESP18 homology domain.
26564179 2016 Influence of HLA-DR and -DQ alleles on autoantibody recognition of distinct epitopes within the juxtamembrane domain of the IA-2 autoantigen in type 1 diabetes.
25645784 Tyrosine-phosphatase and glutamate-decarboxylase antibodies after simultaneous pancreas kidney transplantation: do they have an impact on pancreas graft survival?
25561468 2015 Stability of proICA512/IA-2 and its targeting to insulin secretory granules require ?4-sheet-mediated dimerization of its ectodomain in the endoplasmic reticulum.
25528004 2015 The minimal promoter region of the dense-core vesicle protein IA-2: transcriptional regulation by CREB.
25416956 2014 A proteome-scale map of the human interactome network.
24843546 2012 Sorting nexin 19 regulates the number of dense core vesicles in pancreatic ?-cells.
23396399 2013 Humoral responses to islet antigen-2 and zinc transporter 8 are attenuated in patients carrying HLA-A*24 alleles at the onset of type 1 diabetes.
23234360 2013 LC-MS/MS characterization of O-glycosylation sites and glycan structures of human cerebrospinal fluid glycoproteins.
23110943 2012 IA-2 autoantibody affinity in children at risk for type 1 diabetes.
More...