Property Summary

NCBI Gene PubMed Count 76
PubMed Score 137.31
PubTator Score 106.46

Knowledge Summary

Patent (24,160)

TINX Plot

  Disease Sources (6)

Disease Target Count P-value
ovarian cancer 8492 4.76281609084626E-16
lung adenocarcinoma 2714 2.73658188599788E-15
posterior fossa group A ependymoma 1511 2.21472789578492E-9
lung carcinoma 2844 5.50868160389538E-9
malignant mesothelioma 3163 2.55229386408325E-7
osteosarcoma 7933 1.83155017124345E-6
psoriasis 6685 1.24673322298992E-5
Duchenne muscular dystrophy 602 1.54159009078341E-5
lung cancer 4473 2.43855124060747E-5
primary pancreatic ductal adenocarcinoma 1271 4.27871703312034E-5
pancreatic cancer 2300 6.6911823039963E-5
breast carcinoma 1614 7.40614907475797E-5
intraductal papillary-mucinous adenoma (IPMA) 2956 8.67316932805636E-5
group 4 medulloblastoma 1875 1.38671088705547E-4
glioblastoma 5572 1.65793452553487E-4
invasive ductal carcinoma 2950 2.197144178554E-4
intraductal papillary-mucinous carcinoma (IPMC) 2988 3.89469109464472E-4
Pick disease 1893 4.02555899141549E-4
ductal carcinoma in situ 1745 4.07176883773846E-4
pediatric high grade glioma 2712 6.56635436764292E-4
pilocytic astrocytoma 3086 8.95731615802172E-4
colon cancer 1475 0.00247960528291476
Atopic dermatitis 944 0.00250746326697364
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.00269974338422218
ulcerative colitis 2087 0.00271202342695684
subependymal giant cell astrocytoma 2287 0.00316460946368232
medulloblastoma, large-cell 6234 0.00399955123609211
astrocytoma 1493 0.00517921145908234
autosomal dominant Emery-Dreifuss muscular dystrophy 499 0.00586112139298798
tuberculosis 1563 0.00719688289052426
oligodendroglioma 2849 0.00792055792962743
fibroadenoma 557 0.0227179695539704
atypical teratoid / rhabdoid tumor 4369 0.0253505766570871
adrenocortical carcinoma 1427 0.0349518887065848
interstitial lung disease 292 0.0424861581738968
Disease Target Count Z-score Confidence
Osteoarthritis 96 3.774 1.9
Cancer 2346 3.656 1.8

Expression

Synonym

Accession Q16832 Q7Z730 Discoidin domain receptor 2
Symbols TKT
MIG20a
NTRKR3
TYRO10

Gene

PDB

2WUH   2Z4F  

  Ortholog (9)

MLP Assay (1)

AID Type Active / Inconclusive / Inactive Description
1982 other 0 / 0 / 0 Kinase inhibition selectivity assay for compound SID-48409448

Gene RIF (60)

PMID Text
26772530 Ang II induces cardiac fibrosis by enhancing DDR2 expression in cardiac fibroblasts via p38 MAPK-mediated activation of NF-kappaB.
26702058 Data suggest SCl2 (Streptococcus pyogenes) binds to DDR (DDR1, DDR2) ectodomain w/o stimulating receptor signaling; here, protein engineering was used to construct SCl-like proteins that inhibit collagen-DDR interactions and macrophage migration.
26463668 DDR2 Missense mutation is associated with spondylo-meta-epiphyseal dysplasia, short limb-abnormal calcification type.
26362312 DDR2 plays an important role in promoting hepatocellular carcinoma cell invasion and migration by stabilizing SNA1.
26271983 Data show that discoidin domain receptor 2 (DDR2) is linked to a polyubiquitin (Ub) chain predominantly through lysine K27 conjugation and slightly through K33.
26191278 Report correlation between increased radiographic grade of knee osteoarthritis and decreased proportion of cartilage stained for DDR2.
26067556 peptide delivered by the AuNP-Apt system inhibited cancer cell proliferation and invasion mediated by DDR2 activation
25842034 The inhibition of DDR2 by RNA interference suppressed in vivo and in vitro growth of human hepatocellular carcinoma cells.
25667101 A DDR1(Low)/DDR2(High) protein profile is associated with TNBC and may identify invasive carcinomas with worse prognosis.
25658585 Identified are 3 Single Nucleotide Polymorphisms in DDR2 significantly associated with hip bone mineral density in the Chinese population.
More...

AA Sequence

MILIPRMLLVLFLLLPILSSAKAQVNPAICRYPLGMSGGQIPDEDITASSQWSESTAAKYGRLDSEEGDG      1 - 70
AWCPEIPVEPDDLKEFLQIDLHTLHFITLVGTQGRHAGGHGIEFAPMYKINYSRDGTRWISWRNRHGKQV     71 - 140
LDGNSNPYDIFLKDLEPPIVARFVRFIPVTDHSMNVCMRVELYGCVWLDGLVSYNAPAGQQFVLPGGSII    141 - 210
YLNDSVYDGAVGYSMTEGLGQLTDGVSGLDDFTQTHEYHVWPGYDYVGWRNESATNGYIEIMFEFDRIRN    211 - 280
FTTMKVHCNNMFAKGVKIFKEVQCYFRSEASEWEPNAISFPLVLDDVNPSARFVTVPLHHRMASAIKCQY    281 - 350
HFADTWMMFSEITFQSDAAMYNNSEALPTSPMAPTTYDPMLKVDDSNTRILIGCLVAIIFILLAIIVIIL    351 - 420
WRQFWQKMLEKASRRMLDDEMTVSLSLPSDSSMFNNNRSSSPSEQGSNSTYDRIFPLRPDYQEPSRLIRK    421 - 490
LPEFAPGEEESGCSGVVKPVQPSGPEGVPHYAEADIVNLQGVTGGNTYSVPAVTMDLLSGKDVAVEEFPR    491 - 560
KLLTFKEKLGEGQFGEVHLCEVEGMEKFKDKDFALDVSANQPVLVAVKMLRADANKNARNDFLKEIKIMS    561 - 630
RLKDPNIIHLLAVCITDDPLCMITEYMENGDLNQFLSRHEPPNSSSSDVRTVSYTNLKFMATQIASGMKY    631 - 700
LSSLNFVHRDLATRNCLVGKNYTIKIADFGMSRNLYSGDYYRIQGRAVLPIRWMSWESILLGKFTTASDV    701 - 770
WAFGVTLWETFTFCQEQPYSQLSDEQVIENTGEFFRDQGRQTYLPQPAICPDSVYKLMLSCWRRDTKNRP    771 - 840
SFQEIHLLLLQQGDE                                                           841 - 855
//

Text Mined References (85)

PMID Year Title
26772530 2016 May the fibrosis be with you: Is discoidin domain receptor 2 the receptor we have been looking for?
26702058 2016 Recombinant Collagen Engineered to Bind to Discoidin Domain Receptor Functions as a Receptor Inhibitor.
26463668 2016 Novel DDR2 mutation identified by whole exome sequencing in a Moroccan patient with spondylo-meta-epiphyseal dysplasia, short limb-abnormal calcification type.
26362312 2015 DDR2 facilitates hepatocellular carcinoma invasion and metastasis via activating ERK signaling and stabilizing SNAIL1.
26271983 2015 [The attachment manner of ubiquitin to proinflammatory molecule discoidin domain receptor 2].
26191278 2015 Evaluation of correlation of articular cartilage staining for DDR2 and proteoglycans with histological tissue damage and the results of radiographic assessment in patients with early stages of knee osteoarthritis.
26067556 2015 Inhibition of discoidin domain receptor 2-mediated lung cancer cells progression by gold nanoparticle-aptamer-assisted delivery of peptides containing transmembrane-juxtamembrane 1/2 domain.
25842034 2015 Downregulation of discoidin domain receptor 2 decreases tumor growth of hepatocellular carcinoma.
25667101 2015 Tyrosine kinase discoidin domain receptors DDR1 and DDR2 are coordinately deregulated in triple-negative breast cancer.
25658585 2015 Genetic analysis identifies DDR2 as a novel gene affecting bone mineral density and osteoporotic fractures in Chinese population.
More...