Property Summary

NCBI Gene PubMed Count 76
Grant Count 71
R01 Count 20
Funding $8,241,149.24
PubMed Score 137.31
PubTator Score 106.46

Knowledge Summary

Patent (24,160)

TINX Plot

  Disease Relevance (53)

Disease Z-score Confidence
Osteoarthritis 96 3.774 1.9
Cancer 2,346 3.656 1.8
Adenocarcinoma of lung (disorder) 48
Atopic dermatitis 944
Blastic phase chronic myeloid leukemia 58
Carcinoma of thyroid 17
Chronic Myelocytic Leukemia Accelerated ... 59 
Chronic eosinophilic leukemia 11
Chronic phase chronic myeloid leukemia 45
Dermatofibrosarcoma protuberans 16
Duchenne muscular dystrophy 602
Gastrointestinal stromal tumor 61
Idiopathic hypereosinophilic syndrome 9
Liver cell carcinoma 15
Myelodysplastic/ Myeloproliferative Dise... 9 
Philadelphia Chromosome Positive Chronic... 45 
Philadelphia chromosome-positive acute l... 47 
Pick disease 1,893
Renal Cell Carcinoma 199
SPONDYLOMETAEPIPHYSEAL DYSPLASIA, SHORT ... 1 
Systemic mast cell disease 12
adrenocortical carcinoma 1,427
astrocytoma 1,493
atypical teratoid / rhabdoid tumor 4,369
autosomal dominant Emery-Dreifuss muscul... 499 
breast carcinoma 1,614
colon cancer 1,475
ductal carcinoma in situ 1,745
fibroadenoma 557
glioblastoma 5,572
group 4 medulloblastoma 1,875
interstitial lung disease 291
intraductal papillary-mucinous adenoma (... 2,956 
intraductal papillary-mucinous carcinoma... 2,988 
intraductal papillary-mucinous neoplasm ... 3,289 
invasive ductal carcinoma 2,950
lung adenocarcinoma 2,713
lung cancer 4,466
lung carcinoma 2,844
malignant mesothelioma 3,162
medulloblastoma, large-cell 6,234
oligodendroglioma 2,849
osteosarcoma 7,933
ovarian cancer 8,484
pancreatic cancer 2,300
pediatric high grade glioma 2,712
pilocytic astrocytoma 3,086
posterior fossa group A ependymoma 1,511
primary pancreatic ductal adenocarcinoma 1,271
psoriasis 6,685
subependymal giant cell astrocytoma 2,287
tuberculosis 1,557
ulcerative colitis 2,087

Expression

Synonym

Accession Q16832 Q7Z730 Discoidin domain receptor 2
Symbols TKT
MIG20a
NTRKR3
TYRO10

Gene

PDB

2WUH   2Z4F  

MLP Assay (1)

AID Type Active / Inconclusive / Inactive Description
1982 other 0 / 0 / 0 Kinase inhibition selectivity assay for compound SID-48409448

Gene RIF (60)

PMID Text
26772530 Ang II induces cardiac fibrosis by enhancing DDR2 expression in cardiac fibroblasts via p38 MAPK-mediated activation of NF-kappaB.
26702058 Data suggest SCl2 (Streptococcus pyogenes) binds to DDR (DDR1, DDR2) ectodomain w/o stimulating receptor signaling; here, protein engineering was used to construct SCl-like proteins that inhibit collagen-DDR interactions and macrophage migration.
26463668 DDR2 Missense mutation is associated with spondylo-meta-epiphyseal dysplasia, short limb-abnormal calcification type.
26362312 DDR2 plays an important role in promoting hepatocellular carcinoma cell invasion and migration by stabilizing SNA1.
26271983 Data show that discoidin domain receptor 2 (DDR2) is linked to a polyubiquitin (Ub) chain predominantly through lysine K27 conjugation and slightly through K33.
26191278 Report correlation between increased radiographic grade of knee osteoarthritis and decreased proportion of cartilage stained for DDR2.
26067556 peptide delivered by the AuNP-Apt system inhibited cancer cell proliferation and invasion mediated by DDR2 activation
25842034 The inhibition of DDR2 by RNA interference suppressed in vivo and in vitro growth of human hepatocellular carcinoma cells.
25667101 A DDR1(Low)/DDR2(High) protein profile is associated with TNBC and may identify invasive carcinomas with worse prognosis.
25658585 Identified are 3 Single Nucleotide Polymorphisms in DDR2 significantly associated with hip bone mineral density in the Chinese population.
More...

AA Sequence

MILIPRMLLVLFLLLPILSSAKAQVNPAICRYPLGMSGGQIPDEDITASSQWSESTAAKYGRLDSEEGDG      1 - 70
AWCPEIPVEPDDLKEFLQIDLHTLHFITLVGTQGRHAGGHGIEFAPMYKINYSRDGTRWISWRNRHGKQV     71 - 140
LDGNSNPYDIFLKDLEPPIVARFVRFIPVTDHSMNVCMRVELYGCVWLDGLVSYNAPAGQQFVLPGGSII    141 - 210
YLNDSVYDGAVGYSMTEGLGQLTDGVSGLDDFTQTHEYHVWPGYDYVGWRNESATNGYIEIMFEFDRIRN    211 - 280
FTTMKVHCNNMFAKGVKIFKEVQCYFRSEASEWEPNAISFPLVLDDVNPSARFVTVPLHHRMASAIKCQY    281 - 350
HFADTWMMFSEITFQSDAAMYNNSEALPTSPMAPTTYDPMLKVDDSNTRILIGCLVAIIFILLAIIVIIL    351 - 420
WRQFWQKMLEKASRRMLDDEMTVSLSLPSDSSMFNNNRSSSPSEQGSNSTYDRIFPLRPDYQEPSRLIRK    421 - 490
LPEFAPGEEESGCSGVVKPVQPSGPEGVPHYAEADIVNLQGVTGGNTYSVPAVTMDLLSGKDVAVEEFPR    491 - 560
KLLTFKEKLGEGQFGEVHLCEVEGMEKFKDKDFALDVSANQPVLVAVKMLRADANKNARNDFLKEIKIMS    561 - 630
RLKDPNIIHLLAVCITDDPLCMITEYMENGDLNQFLSRHEPPNSSSSDVRTVSYTNLKFMATQIASGMKY    631 - 700
LSSLNFVHRDLATRNCLVGKNYTIKIADFGMSRNLYSGDYYRIQGRAVLPIRWMSWESILLGKFTTASDV    701 - 770
WAFGVTLWETFTFCQEQPYSQLSDEQVIENTGEFFRDQGRQTYLPQPAICPDSVYKLMLSCWRRDTKNRP    771 - 840
SFQEIHLLLLQQGDE                                                           841 - 855
//

Text Mined References (85)

PMID Year Title
26772530 2016 May the fibrosis be with you: Is discoidin domain receptor 2 the receptor we have been looking for?
26702058 2016 Recombinant Collagen Engineered to Bind to Discoidin Domain Receptor Functions as a Receptor Inhibitor.
26463668 2016 Novel DDR2 mutation identified by whole exome sequencing in a Moroccan patient with spondylo-meta-epiphyseal dysplasia, short limb-abnormal calcification type.
26362312 2015 DDR2 facilitates hepatocellular carcinoma invasion and metastasis via activating ERK signaling and stabilizing SNAIL1.
26271983 2015 [The attachment manner of ubiquitin to proinflammatory molecule discoidin domain receptor 2].
26191278 2015 Evaluation of correlation of articular cartilage staining for DDR2 and proteoglycans with histological tissue damage and the results of radiographic assessment in patients with early stages of knee osteoarthritis.
26067556 2015 Inhibition of discoidin domain receptor 2-mediated lung cancer cells progression by gold nanoparticle-aptamer-assisted delivery of peptides containing transmembrane-juxtamembrane 1/2 domain.
25842034 2015 Downregulation of discoidin domain receptor 2 decreases tumor growth of hepatocellular carcinoma.
25667101 2015 Tyrosine kinase discoidin domain receptors DDR1 and DDR2 are coordinately deregulated in triple-negative breast cancer.
25658585 2015 Genetic analysis identifies DDR2 as a novel gene affecting bone mineral density and osteoporotic fractures in Chinese population.
More...