Property Summary

Ligand Count 41
NCBI Gene PubMed Count 88
PubMed Score 152.14
PubTator Score 106.46

Knowledge Summary

Patent (24,160)

TINX Plot

  Disease (8)

Disease Target Count
Acquired scoliosis 281
Adenocarcinoma of lung (disorder) 60
Anterior rib cupping 6
Atlantoaxial instability 3
Autosomal recessive predisposition 1442
Bell-shaped thorax 10
Broad metacarpals 5
Byzanthine arch palate 194
C1-C2 subluxation 3
Calcification of falx cerebri 6
Calcification of trachea 3
Carpal calcifications 2
Cognitive delay 608
Compression of spinal cord 10
Concave bridge of nose 195
Congenital anomaly of neck 19
Curvature of spine 282
Decreased projection of midface 105
Deformity of neck 19
Depressed nasal bridge 195
Depressed nasal root/bridge 195
Disproportionately long fibula 4
Exophthalmos 112
Flared iliac wings 13
Flexion contracture - elbow 32
Frontal bossing 157
Genu varum 29
Global developmental delay 608
Hypoplastic mandible condyle 275
Hypotrophic malar bone 129
Hypotrophic midface 105
Infectious disease of lung 29
Malar flattening 129
Malformation of the neck 19
Mandibular hypoplasia 275
Mental and motor retardation 608
Metatarsus Varus 24
Micrognathism 275
Micromelia 58
Midface retrusion 105
Multiple pulmonary infections 29
Muscle hypotonia 571
ODONTOID HYPOPLASIA 16
Orbital separation excessive 244
Pectus excavatum 100
Platyspondyly 56
Posterior rib cupping 5
Progressive calcification of costochondral cartilage 1
Prominent eyes 96
Prominent globes 96
Protruding eyes 96
Recurrent pneumonia 29
Recurrent pulmonary infections 29
Restrictive lung disease 11
Restrictive ventilatory defect 11
Short limb dwarfism, disproportionate 22
Short metacarpal 43
Short nose 132
Short phalanx of finger 32
Short ribs 30
Short tubular bones 22
Small midface 105
Small nose 132
Splayed metaphyses 19
Spondyloepimetaphyseal disorder 9
Stippled epiphyses 28
Syringomyelia 15
Thoracic hypoplasia 14
Toeing-in 24
Triangular shaped distal phalanges of the hand 1
Widened phalanges 4
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 1.0
Kidney cancer 2613 0.0 0.6
Disease Target Count Z-score Confidence
lung cancer 4740 0.0 2.43855124060747E-5
Disease Target Count Z-score Confidence
Osteoarthritis 184 3.782 1.9
Cancer 2499 3.775 1.9

Expression

  Differential Expression (35)

Disease log2 FC p
lung cancer -2.300 2.4e-05
adrenocortical carcinoma -1.362 3.5e-02
adult high grade glioma 1.200 7.0e-03
astrocytic glioma 2.000 8.3e-03
Astrocytoma, Pilocytic 1.300 1.1e-03
Atopic dermatitis -1.200 2.5e-03
atypical teratoid / rhabdoid tumor 1.100 2.5e-02
autosomal dominant Emery-Dreifuss muscul... 1.010 6.9e-03
breast carcinoma -1.700 7.4e-05
colon cancer -2.100 2.5e-03
Duchenne muscular dystrophy 1.130 1.5e-05
ductal carcinoma in situ -1.900 1.3e-03
ependymoma 1.600 4.8e-02
fibroadenoma -1.600 3.0e-02
glioblastoma 2.100 1.7e-04
group 3 medulloblastoma -1.100 3.8e-02
interstitial lung disease 1.200 4.2e-02
intraductal papillary-mucinous adenoma (... -2.700 8.7e-05
intraductal papillary-mucinous carcinoma... -2.800 3.9e-04
intraductal papillary-mucinous neoplasm ... -2.500 2.7e-03
invasive ductal carcinoma -2.900 4.1e-04
lung adenocarcinoma -1.700 2.7e-15
lung carcinoma -1.200 4.1e-08
malignant mesothelioma -2.600 2.6e-07
medulloblastoma, large-cell 1.100 4.0e-03
oligodendroglioma 2.000 7.9e-03
osteosarcoma 3.303 1.8e-06
ovarian cancer -3.200 4.8e-16
pancreatic cancer 1.300 7.1e-03
Pick disease 1.700 4.0e-04
primary pancreatic ductal adenocarcinoma 2.935 4.3e-05
psoriasis -1.100 1.2e-05
subependymal giant cell astrocytoma 2.907 2.6e-03
tuberculosis -1.200 7.2e-03
ulcerative colitis 1.500 2.7e-03

Gene RIF (71)

AA Sequence

MILIPRMLLVLFLLLPILSSAKAQVNPAICRYPLGMSGGQIPDEDITASSQWSESTAAKYGRLDSEEGDG      1 - 70
AWCPEIPVEPDDLKEFLQIDLHTLHFITLVGTQGRHAGGHGIEFAPMYKINYSRDGTRWISWRNRHGKQV     71 - 140
LDGNSNPYDIFLKDLEPPIVARFVRFIPVTDHSMNVCMRVELYGCVWLDGLVSYNAPAGQQFVLPGGSII    141 - 210
YLNDSVYDGAVGYSMTEGLGQLTDGVSGLDDFTQTHEYHVWPGYDYVGWRNESATNGYIEIMFEFDRIRN    211 - 280
FTTMKVHCNNMFAKGVKIFKEVQCYFRSEASEWEPNAISFPLVLDDVNPSARFVTVPLHHRMASAIKCQY    281 - 350
HFADTWMMFSEITFQSDAAMYNNSEALPTSPMAPTTYDPMLKVDDSNTRILIGCLVAIIFILLAIIVIIL    351 - 420
WRQFWQKMLEKASRRMLDDEMTVSLSLPSDSSMFNNNRSSSPSEQGSNSTYDRIFPLRPDYQEPSRLIRK    421 - 490
LPEFAPGEEESGCSGVVKPVQPSGPEGVPHYAEADIVNLQGVTGGNTYSVPAVTMDLLSGKDVAVEEFPR    491 - 560
KLLTFKEKLGEGQFGEVHLCEVEGMEKFKDKDFALDVSANQPVLVAVKMLRADANKNARNDFLKEIKIMS    561 - 630
RLKDPNIIHLLAVCITDDPLCMITEYMENGDLNQFLSRHEPPNSSSSDVRTVSYTNLKFMATQIASGMKY    631 - 700
LSSLNFVHRDLATRNCLVGKNYTIKIADFGMSRNLYSGDYYRIQGRAVLPIRWMSWESILLGKFTTASDV    701 - 770
WAFGVTLWETFTFCQEQPYSQLSDEQVIENTGEFFRDQGRQTYLPQPAICPDSVYKLMLSCWRRDTKNRP    771 - 840
SFQEIHLLLLQQGDE                                                           841 - 855
//

Text Mined References (97)

PMID Year Title