Property Summary

NCBI Gene PubMed Count 17
PubMed Score 11.83
PubTator Score 12.12

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (16)

Disease log2 FC p
adult high grade glioma -1.600 1.6e-04
astrocytic glioma -1.500 1.1e-02
atypical teratoid / rhabdoid tumor -2.500 1.4e-08
colon cancer 1.200 1.8e-03
ependymoma -2.000 1.3e-02
esophageal adenocarcinoma -1.700 2.0e-02
glioblastoma -1.100 6.1e-06
group 4 medulloblastoma -2.200 4.1e-06
hereditary spastic paraplegia 1.290 3.2e-04
nephrosclerosis 1.150 1.1e-04
non primary Sjogren syndrome sicca 1.500 1.2e-02
osteosarcoma 1.393 8.8e-06
ovarian cancer -1.100 9.1e-04
primitive neuroectodermal tumor -1.300 3.1e-04
subependymal giant cell astrocytoma -1.244 2.2e-02
ulcerative colitis 2.100 1.8e-09

Protein-protein Interaction (2)

Gene RIF (3)

AA Sequence

MKNQLRGPPARAHMSTSGAAAAGGTRAGSEPGAGSGSGAGTGAGAATGAGAMPCKSAEWLQEELEARGGA      1 - 70
SLLLLDCRPHELFESSHIETAINLAIPGLMLRRLRKGNLPIRSIIPNHADKERFATRCKAATVLLYDEAT     71 - 140
AEWQPEPGAPASVLGLLLQKLRDDGCQAYYLQGGFNKFQTEYSEHCETNVDSSSSPSSSPPTSVLGLGGL    141 - 210
RISSDCSDGESDRELPSSATESDGSPVPSSQPAFPVQILPYLYLGCAKDSTNLDVLGKYGIKYILNVTPN    211 - 280
LPNAFEHGGEFTYKQIPISDHWSQNLSQFFPEAISFIDEARSKKCGVLVHCLAGISRSVTVTVAYLMQKM    281 - 350
NLSLNDAYDFVKRKKSNISPNFNFMGQLLDFERTLGLSSPCDNHASSEQLYFSTPTNHNLFPLNTLEST     351 - 419
//

Text Mined References (18)

PMID Year Title