Property Summary

NCBI Gene PubMed Count 16
Grant Count 6
R01 Count 5
Funding $431,162.67
PubMed Score 10.45
PubTator Score 12.12

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (16)

Disease log2 FC p
nephrosclerosis 1.150 0.000
astrocytic glioma -1.500 0.011
ependymoma -2.200 0.000
esophageal adenocarcinoma -1.700 0.020
osteosarcoma 1.393 0.000
glioblastoma -1.700 0.000
medulloblastoma -2.300 0.000
atypical teratoid / rhabdoid tumor -2.500 0.000
primitive neuroectodermal tumor -1.300 0.000
hereditary spastic paraplegia 1.290 0.000
colon cancer 1.200 0.002
adult high grade glioma -1.600 0.000
non primary Sjogren syndrome sicca 1.500 0.012
subependymal giant cell astrocytoma -1.244 0.022
ulcerative colitis 2.100 0.000
ovarian cancer 2.000 0.000

Gene RIF (2)

PMID Text
14674243 overexpressed in acute myelogenous leukemia
14576828 high levels of Pyst2-L detected in the active state of AML and ALL diseases and in other types of cancer reflect an altered MAPK signaling pathway in such malignant processes

AA Sequence

MKNQLRGPPARAHMSTSGAAAAGGTRAGSEPGAGSGSGAGTGAGAATGAGAMPCKSAEWLQEELEARGGA      1 - 70
SLLLLDCRPHELFESSHIETAINLAIPGLMLRRLRKGNLPIRSIIPNHADKERFATRCKAATVLLYDEAT     71 - 140
AEWQPEPGAPASVLGLLLQKLRDDGCQAYYLQGGFNKFQTEYSEHCETNVDSSSSPSSSPPTSVLGLGGL    141 - 210
RISSDCSDGESDRELPSSATESDGSPVPSSQPAFPVQILPYLYLGCAKDSTNLDVLGKYGIKYILNVTPN    211 - 280
LPNAFEHGGEFTYKQIPISDHWSQNLSQFFPEAISFIDEARSKKCGVLVHCLAGISRSVTVTVAYLMQKM    281 - 350
NLSLNDAYDFVKRKKSNISPNFNFMGQLLDFERTLGLSSPCDNHASSEQLYFSTPTNHNLFPLNTLEST     351 - 419
//

Text Mined References (17)

PMID Year Title
24656772 2014 SPOP promotes tumorigenesis by acting as a key regulatory hub in kidney cancer.
19228121 2009 Dual-specificity phosphatases: critical regulators with diverse cellular targets.
17322878 2007 A module of negative feedback regulators defines growth factor signaling.
16641997 2006 The DNA sequence, annotation and analysis of human chromosome 3.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15276183 2004 MD-2: the Toll 'gatekeeper' in endotoxin signalling.
15146197 2004 Transcriptome characterization elucidates signaling networks that control human ES cell growth and differentiation.
15081539 2004 Does the dual-specificity MAPK phosphatase Pyst2-L lead a monogamous relationship with the Erk2 protein?
14674243 2003 cDNA microarray analysis reveals an overexpression of the dual-specificity MAPK phosphatase PYST2 in acute leukemia.
14603440 2004 Characterization of the dual-specificity phosphatase PYST2 and its transcripts.
More...