Property Summary

NCBI Gene PubMed Count 77
Grant Count 71
R01 Count 57
Funding $5,190,499.74
PubMed Score 169.53
PubTator Score 114.93

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession Q16828 O75109 Q53Y75 Q9BSH6
Symbols HH19
MKP3
PYST1

Gene

PDB

1HZM   1MKP  

Gene RIF (60)

PMID Text
27156317 DNA samples from each patient were genotyped for DUSP6 and TOP2A SNPs
26097584 Suppression of the FOXA1/DUSP6 signaling pathway may contribute to the development of Hirschsprung disease.
25499223 These observations led us to conclude that increased TSH signaling overcomes OIS and is essential for B-RafV600E-induced papillary thyroid carcinogenesis.
25451692 Dusp6 expression was higher in progestin-sensitive atypical endometrial hyperplasia groups compared with progestin-resistant groups. After treatment, Dusp6 expression was upregulated in progestin-sensitive groups, but not in progestin-resistant groups.
25414256 These results therefore indicate that p53-mediated up-regulation of MKP-3 contributes to the establishment of the senescent cellular phenotype through dephosphorylating ERK1/2
25344212 Our results suggest that DUSP6 gene expression in tumour samples may be a prognostic marker in NSCLC
25241655 DUSP6 downregulated the expression of matrix metallopeptidase 3.
24709168 Higher expression of DUSP6 in tumor tissue, than in peritumor tissue, is associated with the recurrence after curative resection of HCC, and the relative tumor DUSP6 expression has good power to predict the recurrence of HCC.
24681741 Downregulation of Dusp6, Sprouty4, and Sef--negative modulators of FGF2/ERK1/2 signaling--was present in eutopic endometria of adenomyosis, which may play critical roles in the development of adenomyosis.
24222120 Increased DUSP6 expression is associated with papillary thyroid carcinoma.
More...

AA Sequence

MIDTLRPVPFASEMAISKTVAWLNEQLELGNERLLLMDCRPQELYESSHIESAINVAIPGIMLRRLQKGN      1 - 70
LPVRALFTRGEDRDRFTRRCGTDTVVLYDESSSDWNENTGGESVLGLLLKKLKDEGCRAFYLEGGFSKFQ     71 - 140
AEFSLHCETNLDGSCSSSSPPLPVLGLGGLRISSDSSSDIESDLDRDPNSATDSDGSPLSNSQPSFPVEI    141 - 210
LPFLYLGCAKDSTNLDVLEEFGIKYILNVTPNLPNLFENAGEFKYKQIPISDHWSQNLSQFFPEAISFID    211 - 280
EARGKNCGVLVHCLAGISRSVTVTVAYLMQKLNLSMNDAYDIVKMKKSNISPNFNFMGQLLDFERTLGLS    281 - 350
SPCDNRVPAQQLYFTTPSNQNVYQVDSLQST                                           351 - 381
//

Text Mined References (78)

PMID Year Title
27156317 2016 Dual Specificity Phosphatase 6 (DUSP6) Polymorphism Predicts Prognosis of Inoperable Non-Small Cell Lung Cancer after Chemoradiotherapy.
26097584 2015 Differential expression of FOXA1, DUSP6, and HA117 in colon segments of Hirschsprung's disease.
25499223 2014 TSH signaling overcomes B-RafV600E-induced senescence in papillary thyroid carcinogenesis through regulation of DUSP6.
25451692 2015 Dual-specificity phosphatase 6 predicts the sensitivity of progestin therapy for atypical endometrial hyperplasia.
25414256 2015 p53 protein-mediated up-regulation of MAP kinase phosphatase 3 (MKP-3) contributes to the establishment of the cellular senescent phenotype through dephosphorylation of extracellular signal-regulated kinase 1/2 (ERK1/2).
25344212 2015 Prognostic value of dual-specificity phosphatase 6 expression in non-small cell lung cancer.
25241655 2014 Dual specificity phosphatase 6 suppresses the growth and metastasis of prostate cancer cells.
24709168 2014 Higher intratumor than peritumor expression of DUSP6/MKP-3 is associated with recurrence after curative resection of hepatocellular carcinoma.
24681741 2014 Loss of expressions of Dusp6, Sprouty4, and Sef, negative regulators of FGF2/ERK1/2 signaling, in the endometrium of women with adenomyosis.
24222120 2013 DNA methylation of MAPK signal-inhibiting genes in papillary thyroid carcinoma.
More...