Property Summary

NCBI Gene PubMed Count 84
PubMed Score 183.51
PubTator Score 114.93

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (6)

Disease Target Count Z-score Confidence
Klinefelter's syndrome 56 0.0 4.0
Disease Target Count Z-score Confidence
Cancer 2499 3.877 1.9

Expression

  Differential Expression (34)

Disease log2 FC p
glioblastoma 1.100 1.7e-02
aldosterone-producing adenoma -1.311 1.5e-02
astrocytoma 2.200 3.8e-02
Astrocytoma, Pilocytic 1.200 9.2e-03
autosomal dominant Emery-Dreifuss muscul... 1.310 3.6e-03
Barrett's esophagus 1.800 1.5e-02
Breast cancer -2.000 1.2e-06
breast carcinoma -1.500 2.8e-27
cutaneous lupus erythematosus 1.400 8.8e-03
cystic fibrosis 2.567 2.0e-06
dermatomyositis 1.200 7.2e-03
diabetes mellitus -1.200 1.8e-02
Duchenne muscular dystrophy 1.143 7.5e-06
esophageal adenocarcinoma 1.400 1.8e-02
gastric cancer 1.600 6.4e-03
group 4 medulloblastoma -2.100 3.1e-03
hepatocellular carcinoma 2.300 2.0e-06
Hydrolethalus syndrome 2.643 6.2e-03
intraductal papillary-mucinous neoplasm ... 1.900 9.0e-03
juvenile dermatomyositis 1.883 4.6e-13
lung carcinoma -1.400 2.4e-11
medulloblastoma, large-cell -2.200 1.0e-02
Multiple myeloma 1.743 1.6e-02
non-small cell lung cancer -1.265 4.7e-10
osteosarcoma 1.290 3.2e-02
ovarian cancer -1.500 1.1e-02
pancreatic cancer 2.100 2.2e-03
pancreatic carcinoma 2.100 2.2e-03
pediatric high grade glioma 1.300 2.8e-02
pituitary cancer -1.600 1.4e-06
posterior fossa group B ependymoma -1.100 3.5e-03
primary pancreatic ductal adenocarcinoma 1.353 7.8e-03
ulcerative colitis 1.700 1.4e-06
Waldenstrons macroglobulinemia 1.469 2.0e-02

 GWAS Trait (1)

Gene RIF (66)

AA Sequence

MIDTLRPVPFASEMAISKTVAWLNEQLELGNERLLLMDCRPQELYESSHIESAINVAIPGIMLRRLQKGN      1 - 70
LPVRALFTRGEDRDRFTRRCGTDTVVLYDESSSDWNENTGGESVLGLLLKKLKDEGCRAFYLEGGFSKFQ     71 - 140
AEFSLHCETNLDGSCSSSSPPLPVLGLGGLRISSDSSSDIESDLDRDPNSATDSDGSPLSNSQPSFPVEI    141 - 210
LPFLYLGCAKDSTNLDVLEEFGIKYILNVTPNLPNLFENAGEFKYKQIPISDHWSQNLSQFFPEAISFID    211 - 280
EARGKNCGVLVHCLAGISRSVTVTVAYLMQKLNLSMNDAYDIVKMKKSNISPNFNFMGQLLDFERTLGLS    281 - 350
SPCDNRVPAQQLYFTTPSNQNVYQVDSLQST                                           351 - 381
//

Text Mined References (84)

PMID Year Title