Property Summary

NCBI Gene PubMed Count 77
PubMed Score 169.53
PubTator Score 114.93

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (5)

Disease Target Count P-value
breast carcinoma 1614 2.7978039941751E-27
juvenile dermatomyositis 1189 2.07336122506381E-12
lung carcinoma 2844 2.4433940296861E-11
non-small cell lung cancer 2798 1.77901417745823E-8
ulcerative colitis 2087 7.97903250963809E-8
cystic fibrosis 1670 3.41528265292769E-7
pituitary cancer 1972 5.79840679981515E-7
ovarian cancer 8492 1.31806943866717E-6
hepatocellular carcinoma 550 2.01355436938423E-6
Duchenne muscular dystrophy 602 7.51138017862659E-6
pancreatic carcinoma 567 0.00216085498067543
pancreatic cancer 2300 0.00216085498067544
group 4 medulloblastoma 1875 0.00305514087355707
autosomal dominant Emery-Dreifuss muscular dystrophy 499 0.00360261309308391
posterior fossa group B ependymoma 1530 0.00399189400439064
medulloblastoma, large-cell 6234 0.00478495963739452
Hydrolethalus syndrome 128 0.00622881614668798
inflammatory breast cancer 404 0.00793054850204407
Multiple myeloma 1328 0.0087153899103804
cutaneous lupus erythematosus 1056 0.00880268032687012
dermatomyositis 967 0.00924694590277212
pilocytic astrocytoma 3086 0.011275724933122
primary pancreatic ductal adenocarcinoma 1271 0.0124455266660991
gastric carcinoma 832 0.0143508500644056
aldosterone-producing adenoma 664 0.0145252434208622
Barrett's esophagus 185 0.0150117323195808
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.0160568357313045
esophageal adenocarcinoma 737 0.0176010007179145
diabetes mellitus 1663 0.0183003973168289
Waldenstrons macroglobulinemia 765 0.0197646301400086
pediatric high grade glioma 2712 0.0279046703003908
osteosarcoma 7933 0.0323768093113732
astrocytoma 1493 0.0384216572341052
Disease Target Count Z-score Confidence
Klinefelter's syndrome 59 0.0 4.0
Disease Target Count Z-score Confidence
Cancer 2346 3.761 1.9

Expression

Synonym

Accession Q16828 O75109 Q53Y75 Q9BSH6
Symbols HH19
MKP3
PYST1

Gene

PDB

1HZM   1MKP  

  Ortholog (10)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA Inparanoid
Rat OMA Inparanoid
Dog OMA Inparanoid
Cow OMA Inparanoid
Opossum OMA Inparanoid
Chicken OMA Inparanoid
Anole lizard OMA Inparanoid
Xenopus OMA Inparanoid

Gene RIF (60)

PMID Text
27156317 DNA samples from each patient were genotyped for DUSP6 and TOP2A SNPs
26097584 Suppression of the FOXA1/DUSP6 signaling pathway may contribute to the development of Hirschsprung disease.
25499223 These observations led us to conclude that increased TSH signaling overcomes OIS and is essential for B-RafV600E-induced papillary thyroid carcinogenesis.
25451692 Dusp6 expression was higher in progestin-sensitive atypical endometrial hyperplasia groups compared with progestin-resistant groups. After treatment, Dusp6 expression was upregulated in progestin-sensitive groups, but not in progestin-resistant groups.
25414256 These results therefore indicate that p53-mediated up-regulation of MKP-3 contributes to the establishment of the senescent cellular phenotype through dephosphorylating ERK1/2
25344212 Our results suggest that DUSP6 gene expression in tumour samples may be a prognostic marker in NSCLC
25241655 DUSP6 downregulated the expression of matrix metallopeptidase 3.
24709168 Higher expression of DUSP6 in tumor tissue, than in peritumor tissue, is associated with the recurrence after curative resection of HCC, and the relative tumor DUSP6 expression has good power to predict the recurrence of HCC.
24681741 Downregulation of Dusp6, Sprouty4, and Sef--negative modulators of FGF2/ERK1/2 signaling--was present in eutopic endometria of adenomyosis, which may play critical roles in the development of adenomyosis.
24222120 Increased DUSP6 expression is associated with papillary thyroid carcinoma.
More...

AA Sequence

MIDTLRPVPFASEMAISKTVAWLNEQLELGNERLLLMDCRPQELYESSHIESAINVAIPGIMLRRLQKGN      1 - 70
LPVRALFTRGEDRDRFTRRCGTDTVVLYDESSSDWNENTGGESVLGLLLKKLKDEGCRAFYLEGGFSKFQ     71 - 140
AEFSLHCETNLDGSCSSSSPPLPVLGLGGLRISSDSSSDIESDLDRDPNSATDSDGSPLSNSQPSFPVEI    141 - 210
LPFLYLGCAKDSTNLDVLEEFGIKYILNVTPNLPNLFENAGEFKYKQIPISDHWSQNLSQFFPEAISFID    211 - 280
EARGKNCGVLVHCLAGISRSVTVTVAYLMQKLNLSMNDAYDIVKMKKSNISPNFNFMGQLLDFERTLGLS    281 - 350
SPCDNRVPAQQLYFTTPSNQNVYQVDSLQST                                           351 - 381
//

Text Mined References (78)

PMID Year Title
27156317 2016 Dual Specificity Phosphatase 6 (DUSP6) Polymorphism Predicts Prognosis of Inoperable Non-Small Cell Lung Cancer after Chemoradiotherapy.
26097584 2015 Differential expression of FOXA1, DUSP6, and HA117 in colon segments of Hirschsprung's disease.
25499223 2014 TSH signaling overcomes B-RafV600E-induced senescence in papillary thyroid carcinogenesis through regulation of DUSP6.
25451692 2015 Dual-specificity phosphatase 6 predicts the sensitivity of progestin therapy for atypical endometrial hyperplasia.
25414256 2015 p53 protein-mediated up-regulation of MAP kinase phosphatase 3 (MKP-3) contributes to the establishment of the cellular senescent phenotype through dephosphorylation of extracellular signal-regulated kinase 1/2 (ERK1/2).
25344212 2015 Prognostic value of dual-specificity phosphatase 6 expression in non-small cell lung cancer.
25241655 2014 Dual specificity phosphatase 6 suppresses the growth and metastasis of prostate cancer cells.
24709168 2014 Higher intratumor than peritumor expression of DUSP6/MKP-3 is associated with recurrence after curative resection of hepatocellular carcinoma.
24681741 2014 Loss of expressions of Dusp6, Sprouty4, and Sef, negative regulators of FGF2/ERK1/2 signaling, in the endometrium of women with adenomyosis.
24222120 2013 DNA methylation of MAPK signal-inhibiting genes in papillary thyroid carcinoma.
More...