Property Summary

NCBI Gene PubMed Count 50
PubMed Score 57.99
PubTator Score 51.94

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (13)

Disease log2 FC p
astrocytic glioma -1.100 4.2e-02
atypical teratoid / rhabdoid tumor -2.200 1.8e-03
Chronic Lymphocytic Leukemia 1.062 1.5e-02
cutaneous lupus erythematosus 1.500 4.2e-02
ependymoma -1.800 1.8e-02
glioblastoma -1.600 8.5e-03
group 3 medulloblastoma 2.000 2.6e-05
lung cancer 1.500 7.5e-04
medulloblastoma, large-cell 1.500 3.9e-02
non-small cell lung cancer -1.581 8.6e-15
ovarian cancer -2.200 2.0e-11
Pick disease -1.300 8.3e-03
ulcerative colitis -1.300 3.4e-02

Gene RIF (33)

AA Sequence

MGHLPTGIHGARRLLPLLWLFVLFKNATAFHVTVQDDNNIVVSLEASDVISPASVYVVKITGESKNYFFE      1 - 70
FEEFNSTLPPPVIFKASYHGLYYIITLVVVNGNVVTKPSRSITVLTKPLPVTSVSIYDYKPSPETGVLFE     71 - 140
IHYPEKYNVFTRVNISYWEGKDFRTMLYKDFFKGKTVFNHWLPGMCYSNITFQLVSEATFNKSTLVEYSG    141 - 210
VSHEPKQHRTAPYPPQNISVRIVNLNKNNWEEQSGNFPEESFMRSQDTIGKEKLFHFTEETPEIPSGNIS    211 - 280
SGWPDFNSSDYETTSQPYWWDSASAAPESEDEFVSVLPMEYENNSTLSETEKSTSGSFSFFPVQMILTWL    281 - 350
PPKPPTAFDGFHIHIEREENFTEYLMVDEEAHEFVAELKEPGKYKLSVTTFSSSGSCETRKSQSAKSLSF    351 - 420
YISPSGEWIEELTEKPQHVSVHVLSSTTALMSWTSSQENYNSTIVSVVSLTCQKQKESQRLEKQYCTQVN    421 - 490
SSKPIIENLVPGAQYQVVIYLRKGPLIGPPSDPVTFAIVPTGIKDLMLYPLGPTAVVLSWTRPYLGVFRK    491 - 560
YVVEMFYFNPATMTSEWTTYYEIAATVSLTASVRIANLLPAWYYNFRVTMVTWGDPELSCCDSSTISFIT    561 - 630
APVAPEITSVEYFNSLLYISWTYGDDTTDLSHSRMLHWMVVAEGKKKIKKSVTRNVMTAILSLPPGDIYN    631 - 700
LSVTACTERGSNTSMLRLVKLEPAPPKSLFAVNKTQTSVTLLWVEEGVADFFEVFCQQVGSSQKTKLQEP    701 - 770
VAVSSHVVTISSLLPATAYNCSVTSFSHDSPSVPTFIAVSTMVTEMNPNVVVISVLAILSTLLIGLLLVT    771 - 840
LIILRKKHLQMARECGAGTFVNFASLERDGKLPYNWRRSIFAFLTLLPSCLWTDYLLAFYINPWSKNGLK    841 - 910
KRKLTNPVQLDDFDAYIKDMAKDSDYKFSLQFEELKLIGLDIPHFAADLPLNRCKNRYTNILPYDFSRVR    911 - 980
LVSMNEEEGADYINANYIPGYNSPQEYIATQGPLPETRNDFWKMVLQQKSQIIVMLTQCNEKRRVKCDHY    981 - 1050
WPFTEEPIAYGDITVEMISEEEQDDWACRHFRINYADEMQDVMHFNYTAWPDHGVPTANAAESILQFVHM   1051 - 1120
VRQQATKSKGPMIIHCSAGVGRTGTFIALDRLLQHIRDHEFVDILGLVSEMRSYRMSMVQTEEQYIFIHQ   1121 - 1190
CVQLMWMKKKQQFCISDVIYENVSKS                                               1191 - 1216
//

Text Mined References (54)

PMID Year Title