Property Summary

NCBI Gene PubMed Count 45
Grant Count 33
R01 Count 22
Funding $5,300,856.95
PubMed Score 53.68
PubTator Score 51.94

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (13)

Disease log2 FC p
Chronic Lymphocytic Leukemia 1.062 0.015
astrocytic glioma -1.100 0.042
ependymoma -1.800 0.018
cutaneous lupus erythematosus 1.500 0.042
atypical teratoid / rhabdoid tumor -2.200 0.002
glioblastoma -1.600 0.009
medulloblastoma, large-cell 1.500 0.039
non-small cell lung cancer -1.581 0.000
lung cancer 1.500 0.001
group 3 medulloblastoma 2.200 0.006
Pick disease -1.300 0.008
ulcerative colitis -1.300 0.034
ovarian cancer -2.200 0.000

Gene RIF (30)

PMID Text
26117839 PTPRO truncated serves as an important tumor suppressor in hepatocellular carcinoma microenvironment.
25633279 These observations confirm that PTPRO plays a critical role in liver fibrogenesis by affecting PDGF signaling in HSC activation and might be developed into a feasible therapeutic approach for the treatment of chronic fibrotic liver diseases.
25482129 Loss of PTPRO expression is associated with chronic lymphocytic leukemia.
25462809 The optimal pH value of PTP-oc is approximately 7.0.
25339662 PTPRO was drastically decreased in fulminant hepatitis, and this was associated with enhanced beta-catenin accumulation but reduced IFN-gamma secretion.
25301722 Results highlight the PTPRO contribution in negative regulation of SRC/EGFR signaling in colon cancer.
25034527 Our study suggests an interesting PTPRO/TLR4/NF-kappaB signaling feedback loop in Hhepatocellular carcinomcarcinogenesis and progression
24128416 PTPRO level was decreased in the early phase but reversed in the late phase of hepatic ischemia reperfusion injury.
24090193 PTPRO methylation is associated with poor survival only in HER2-positive patients.
23533167 methylation and downregulation of PTPRO in a subset of primary human HCC and establish VCP as a novel functionally important substrate of this tyrosine phosphatase that could be a potential molecular target for HCC therapy.
More...

AA Sequence

MGHLPTGIHGARRLLPLLWLFVLFKNATAFHVTVQDDNNIVVSLEASDVISPASVYVVKITGESKNYFFE      1 - 70
FEEFNSTLPPPVIFKASYHGLYYIITLVVVNGNVVTKPSRSITVLTKPLPVTSVSIYDYKPSPETGVLFE     71 - 140
IHYPEKYNVFTRVNISYWEGKDFRTMLYKDFFKGKTVFNHWLPGMCYSNITFQLVSEATFNKSTLVEYSG    141 - 210
VSHEPKQHRTAPYPPQNISVRIVNLNKNNWEEQSGNFPEESFMRSQDTIGKEKLFHFTEETPEIPSGNIS    211 - 280
SGWPDFNSSDYETTSQPYWWDSASAAPESEDEFVSVLPMEYENNSTLSETEKSTSGSFSFFPVQMILTWL    281 - 350
PPKPPTAFDGFHIHIEREENFTEYLMVDEEAHEFVAELKEPGKYKLSVTTFSSSGSCETRKSQSAKSLSF    351 - 420
YISPSGEWIEELTEKPQHVSVHVLSSTTALMSWTSSQENYNSTIVSVVSLTCQKQKESQRLEKQYCTQVN    421 - 490
SSKPIIENLVPGAQYQVVIYLRKGPLIGPPSDPVTFAIVPTGIKDLMLYPLGPTAVVLSWTRPYLGVFRK    491 - 560
YVVEMFYFNPATMTSEWTTYYEIAATVSLTASVRIANLLPAWYYNFRVTMVTWGDPELSCCDSSTISFIT    561 - 630
APVAPEITSVEYFNSLLYISWTYGDDTTDLSHSRMLHWMVVAEGKKKIKKSVTRNVMTAILSLPPGDIYN    631 - 700
LSVTACTERGSNTSMLRLVKLEPAPPKSLFAVNKTQTSVTLLWVEEGVADFFEVFCQQVGSSQKTKLQEP    701 - 770
VAVSSHVVTISSLLPATAYNCSVTSFSHDSPSVPTFIAVSTMVTEMNPNVVVISVLAILSTLLIGLLLVT    771 - 840
LIILRKKHLQMARECGAGTFVNFASLERDGKLPYNWRRSIFAFLTLLPSCLWTDYLLAFYINPWSKNGLK    841 - 910
KRKLTNPVQLDDFDAYIKDMAKDSDYKFSLQFEELKLIGLDIPHFAADLPLNRCKNRYTNILPYDFSRVR    911 - 980
LVSMNEEEGADYINANYIPGYNSPQEYIATQGPLPETRNDFWKMVLQQKSQIIVMLTQCNEKRRVKCDHY    981 - 1050
WPFTEEPIAYGDITVEMISEEEQDDWACRHFRINYADEMQDVMHFNYTAWPDHGVPTANAAESILQFVHM   1051 - 1120
VRQQATKSKGPMIIHCSAGVGRTGTFIALDRLLQHIRDHEFVDILGLVSEMRSYRMSMVQTEEQYIFIHQ   1121 - 1190
CVQLMWMKKKQQFCISDVIYENVSKS                                               1191 - 1216
//

Text Mined References (49)

PMID Year Title
26117839 2015 PTPROt maintains T cell immunity in the microenvironment of hepatocellular carcinoma.
25633279 2015 PTPRO-associated hepatic stellate cell activation plays a critical role in liver fibrosis.
25482129 2015 PTPROt-mediated regulation of p53/Foxm1 suppresses leukemic phenotype in a CLL mouse model.
25462809 2015 Expression, purification, and characterization of human osteoclastic protein-tyrosine phosphatase catalytic domain in Escherichia coli.
25339662 2014 Survival and inflammation promotion effect of PTPRO in fulminant hepatitis is associated with NF-?B activation.
25301722 2014 The tyrosine phosphatase PTPRO sensitizes colon cancer cells to anti-EGFR therapy through activation of SRC-mediated EGFR signaling.
25034527 2014 Interaction of PTPRO and TLR4 signaling in hepatocellular carcinoma.
24128416 2014 PTPRO plays a dual role in hepatic ischemia reperfusion injury through feedback activation of NF-?B.
24090193 2013 PTPRO promoter methylation is predictive of poorer outcome for HER2-positive breast cancer: indication for personalized therapy.
23533167 2013 Methylation of the PTPRO gene in human hepatocellular carcinoma and identification of VCP as its substrate.
More...