Property Summary

NCBI Gene PubMed Count 27
PubMed Score 22.95
PubTator Score 186.70

Knowledge Summary

Patent

No data available

Expression

Gene RIF (17)

PMID Text
23359326 results demonstrate that hScrib acts as a scaffold to integrate the control of the PP1gamma and ERK signaling pathways and explains how disruption of hScrib localisation can contribute towards the development of human malignancy
19578796 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19056482 Observational study of gene-disease association. (HuGE Navigator)
18232732 PPP1R3A C1984DeltaAG (stop codon 668) isthe 1st prevalent mutation that directly impairs glycogen synthesis & decreases glycogen levels in human skeletal muscle. It is present in approximately 1 in 70 UK whites.
16276364 Observational study of gene-disease association. (HuGE Navigator)
15870946 Observational study of gene-disease association. (HuGE Navigator)
15870946 Inactivation of PPP1R3 gene is associated with tumor progression and metastasis of colorectal cancers
15231141 Observational study of gene-disease association. (HuGE Navigator)
15181086 Observational study of gene-disease association. (HuGE Navigator)
15181086 Among the largest cohort of nondiabetic subjects (Caucasian, n = 112), the presence of the deletion allele (ARE-2) was associated with insulin resistance and hyperandrogenemia.
More...

AA Sequence

MEPSEVPSQISKDNFLEVPNLSDSLCEDEEVTFQPGFSPQPSRRGSDSSEDIYLDTPSSGTRRVSFADSF      1 - 70
GFNLVSVKEFDCWELPSASTTFDLGTDIFHTEEYVLAPLFDLPSSKEDLMQQLQIQKAILESTESLLGST     71 - 140
SIKGIIRVLNVSFEKLVYVRMSLDDWQTHYDILAEYVPNSCDGETDQFSFKIVLVPPYQKDGSKVEFCIR    141 - 210
YETSVGTFWSNNNGTNYTFICQKKEQEPEPVKPWKEVPNRQIKGCLKVKSSKEESSVTSEENNFENPKNT    211 - 280
DTYIPTIICSHEDKEDLEASNRNVKDVNREHDEHNEKELELMINQHLIRTRSTASRDERNTFSTDPVNFP    281 - 350
NKAEGLEKKQIHGEICTDLFQRSLSPSSSAESSVKGDFYCNEKYSSGDDCTHQPSEETTSNMGEIKPSLG    351 - 420
DTSSDELVQLHTGSKEVLDDNANPAHGNGTVQIPCPSSDQLMAGNLNKKHEGGAKNIEVKDLGCLRRDFH    421 - 490
SDTSACLKESTEEGSSKEDYYGNGKDDEEQRIYLGVNEKQRKNFQTILHDQERKMGNPKISVAGIGASNR    491 - 560
DLATLLSEHTAIPTRAITADVSHSPRTNLSWEEAVLTPEHHHLTSEGSALGGITGQVCSSRTGNVLRNDY    561 - 630
LFQVEEKSGGINSEDQDNSPQHKQSWNVLESQGKSRENKTNITEHIKGQTDCEDVWGKRDNTRSLKATTE    631 - 700
ELFTCQETVCCELSSLADHGITEKAEAGTAYIIKTTSESTPESMSAREKAIIAKLPQETARSDRPIEVKE    701 - 770
TAFDPHEGRNDDSHYTLCQRDTVGVIYDNDFEKESRLGICNVRVDEMEKEETMSMYNPRKTHDREKCGTG    771 - 840
NITSVEESSWVITEYQKATSKLDLQLGMLPTDKTVFSENRDLRQVQELSKKTDSDAIVHSAFNSDTNRAP    841 - 910
QNSSPFSKHHTEISVSTNEQAIAVENAVTTMASQPISTKSENICNSTREIQGIEKHPYPESKPEEVSRSS    911 - 980
GIVTSGSRKERCIGQIFQTEEYSVEKSLGPMILINKPLENMEEARHENEGLVSSGQSLYTSGEKESDSSA    981 - 1050
STSLPVEESQAQGNESLFSKYTNSKIPYFLLFLIFLITVYHYDLMIGLTFYVLSLSWLSWEEGRQKESVK   1051 - 1120
KK                                                                       1121 - 1122
//

Text Mined References (28)

PMID Year Title
25189868 2015 Gene-smoking interactions identify several novel blood pressure loci in the Framingham Heart Study.
23359326 2013 A novel interaction between hScrib and PP1? downregulates ERK signaling and suppresses oncogene-induced cell transformation.
19578796 2009 Association of genetic variants with chronic kidney disease in individuals with different lipid profiles.
19056482 2009 Association of a polymorphism of the apolipoprotein E gene with chronic kidney disease in Japanese individuals with metabolic syndrome.
18232732 2008 A prevalent variant in PPP1R3A impairs glycogen synthesis and reduces muscle glycogen content in humans and mice.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
16959974 2006 The consensus coding sequences of human breast and colorectal cancers.
16276364 2006 Clinical and genetic associations with hypertriglyceridemic waist in a Canadian aboriginal population.
15870946 2005 PPP1R3 gene (protein phosphatase 1) alterations in colorectal cancer and its relationship to metastasis.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
More...