Property Summary

NCBI Gene PubMed Count 24
PubMed Score 8.59
PubTator Score 5.79

Knowledge Summary

Patent (604)

Expression

  Differential Expression (7)

Disease log2 FC p
astrocytic glioma 2.100 0.002
ependymoma 1.500 0.031
oligodendroglioma 1.500 0.004
osteosarcoma 1.348 0.000
Duchenne muscular dystrophy -1.119 0.000
autosomal dominant Emery-Dreifuss muscul... -1.124 0.004
dermatomyositis -2.000 0.001

MLP Assay (1)

AID Type Active / Inconclusive / Inactive Description
1982 other 0 / 0 / 0 Kinase inhibition selectivity assay for compound SID-48409448

AA Sequence

MTRDEALPDSHSAQDFYENYEPKEILGRGVSSVVRRCIHKPTSQEYAVKVIDVTGGGSFSPEEVRELREA      1 - 70
TLKEVDILRKVSGHPNIIQLKDTYETNTFFFLVFDLMKRGELFDYLTEKVTLSEKETRKIMRALLEVICT     71 - 140
LHKLNIVHRDLKPENILLDDNMNIKLTDFGFSCQLEPGERLREVCGTPSYLAPEIIECSMNEDHPGYGKE    141 - 210
VDMWSTGVIMYTLLAGSPPFWHRKQMLMLRMIMSGNYQFGSPEWDDYSDTVKDLVSRFLVVQPQNRYTAE    211 - 280
EALAHPFFQQYLVEEVRHFSPRGKFKVIALTVLASVRIYYQYRRVKPVTREIVIRDPYALRPLRRLIDAY    281 - 350
AFRIYGHWVKKGQQQNRAALFENTPKAVLLSLAEEDY                                     351 - 387
//

Text Mined References (26)

PMID Year Title
17692548 2007 In Silico characterization of phosphorylase kinase: evidence for an alternate intronic polyadenylation site in PHKG1.
17344846 2007 Patterns of somatic mutation in human cancer genomes.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12853948 2003 The DNA sequence of human chromosome 7.
12825073 2003 Muscle glycogenosis with low phosphorylase kinase activity: mutations in PHKA1, PHKG1 or six other candidate genes explain only a minority of cases.
12665801 2003 Exploring proteomes and analyzing protein processing by mass spectrometric identification of sorted N-terminal peptides.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12387894 2002 Involvement of aberrant glycosylation in phosphorylation of tau by cdk5 and GSK-3beta.
More...