Property Summary

Ligand Count 5
NCBI Gene PubMed Count 24
PubMed Score 8.64
PubTator Score 5.79

Knowledge Summary

Patent (604)

Expression

  Differential Expression (7)

Disease log2 FC p
astrocytic glioma 2.100 1.6e-03
autosomal dominant Emery-Dreifuss muscul... -1.124 4.3e-03
dermatomyositis -2.000 1.0e-03
Duchenne muscular dystrophy -1.119 8.3e-06
ependymoma 1.500 3.1e-02
oligodendroglioma 1.500 4.4e-03
osteosarcoma 1.348 2.2e-04

AA Sequence

MTRDEALPDSHSAQDFYENYEPKEILGRGVSSVVRRCIHKPTSQEYAVKVIDVTGGGSFSPEEVRELREA      1 - 70
TLKEVDILRKVSGHPNIIQLKDTYETNTFFFLVFDLMKRGELFDYLTEKVTLSEKETRKIMRALLEVICT     71 - 140
LHKLNIVHRDLKPENILLDDNMNIKLTDFGFSCQLEPGERLREVCGTPSYLAPEIIECSMNEDHPGYGKE    141 - 210
VDMWSTGVIMYTLLAGSPPFWHRKQMLMLRMIMSGNYQFGSPEWDDYSDTVKDLVSRFLVVQPQNRYTAE    211 - 280
EALAHPFFQQYLVEEVRHFSPRGKFKVIALTVLASVRIYYQYRRVKPVTREIVIRDPYALRPLRRLIDAY    281 - 350
AFRIYGHWVKKGQQQNRAALFENTPKAVLLSLAEEDY                                     351 - 387
//

Text Mined References (26)

PMID Year Title