Property Summary

Ligand Count 1
NCBI Gene PubMed Count 30
PubMed Score 55.94
PubTator Score 15.14

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (8)

Disease Target Count Z-score Confidence
Leigh disease 100 0.0 4.0
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.7
Disease Target Count Z-score Confidence
Mitochondrial complex I deficiency 46 0.0 5.0
Disease Target Count Z-score Confidence
Listeria meningitis 1 4.074 2.0
Staphyloenterotoxemia 18 3.177 1.6
Disease Target Count
Leigh syndrome 28

Expression

  Differential Expression (8)

Disease log2 FC p
adult high grade glioma -1.100 1.6e-04
atypical teratoid / rhabdoid tumor -1.700 4.1e-09
ependymoma -1.300 9.2e-11
glioblastoma -1.100 2.2e-07
medulloblastoma -1.200 7.0e-06
medulloblastoma, large-cell -1.500 3.2e-05
ovarian cancer 1.200 2.7e-04
subependymal giant cell astrocytoma -1.102 9.6e-03

Gene RIF (7)

AA Sequence

MAAAAQSRVVRVLSMSRSAITAIATSVCHGPPCRQLHHALMPHGKGGRSSVSGIVATVFGATGFLGRYVV      1 - 70
NHLGRMGSQVIIPYRCDKYDIMHLRPMGDLGQLLFLEWDARDKDSIRRVVQHSNVVINLIGRDWETKNFD     71 - 140
FEDVFVKIPQAIAQLSKEAGVEKFIHVSHLNANIKSSSRYLRNKAVGEKVVRDAFPEAIIVKPSDIFGRE    141 - 210
DRFLNSFASMHRFGPIPLGSLGWKTVKQPVYVVDVSKGIVNAVKDPDANGKSFAFVGPSRYLLFHLVKYI    211 - 280
FAVAHRLFLPFPLPLFAYRWVARVFEISPFEPWITRDKVERMHITDMKLPHLPGLEDLGIQATPLELKAI    281 - 350
EVLRRHRTYRWLSAEIEDVKPAKTVNI                                               351 - 377
//

Text Mined References (32)

PMID Year Title