Property Summary

NCBI Gene PubMed Count 230
Grant Count 1,122
R01 Count 589
Funding $196,837,558.86
PubMed Score 948.45
PubTator Score 820.22

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession Q16790 Q5T4R1
Symbols MN
CAIX

Gene

CA9

PANTHER Protein Class (2)

PDB

2HKF   3IAI   5DVX   5FL4   5FL5   5FL6  

Gene RIF (211)

PMID Text
26794023 The intrinsic thermodynamic parameters of compound binding to CA IX helped to draw the compound structure to thermodynamics relationship.
26648580 We used cobalt chloride (CoCl2) as a hypoxia-mimetic agent and found that the expression of HIF-1a protein, CA IX mRNA and protein, is effectively upregulated, except for HIF-1a mRNA.
26648507 Flow cytometrically sorted CA9+ population showed increased mRNA level of a Wnt signaling factor AXIN2. In conclusion, these observations indicate that CA9 expression in normal crypt base cells has association with intestinal epithelial stemness
26553365 We conclude that CA9/miR34 interplay shares in the hypoxic regulation of mammospheres and therefore, may play a relevant role in the hypoxic breast cancer stem cell niche.
26522624 We have developed an efficient system for the production of the catalytic domain of CA IX in methylotrophic yeast Pichia pastoris
26510737 In neuroblastoma cells, CAIX and PGK1 expression is up regulated under hypoxia and correlates with response to targeted anti-proliferative treatment.
26337752 Knockdown of CAIX significantly reduced proliferation of cancer cells, suggesting that rapid efflux of lactate and H(+), as enhanced by CAIX, contributes to cancer cell survival under hypoxic conditions.
26259239 Data indicate that carbonic anhydrase IX (CAIX) inhibition as a relevant therapeutic goal in breast cancer, targeting the migratory, invasive, and metastatic potential of this disease.
26252502 Inhibition of CA9 expression or activity resulted in radiation sensitization of RCC in a preclinical mouse model.
26249175 CAIX expression is increased in hypoxia to compensate for the decrease in its activity produced by a low extracellular pH. A major function of CAIX is to lower the extracellular pH.
More...

AA Sequence

MAPLCPSPWLPLLIPAPAPGLTVQLLLSLLLLVPVHPQRLPRMQEDSPLGGGSSGEDDPLGEEDLPSEED      1 - 70
SPREEDPPGEEDLPGEEDLPGEEDLPEVKPKSEEEGSLKLEDLPTVEAPGDPQEPQNNAHRDKEGDDQSH     71 - 140
WRYGGDPPWPRVSPACAGRFQSPVDIRPQLAAFCPALRPLELLGFQLPPLPELRLRNNGHSVQLTLPPGL    141 - 210
EMALGPGREYRALQLHLHWGAAGRPGSEHTVEGHRFPAEIHVVHLSTAFARVDEALGRPGGLAVLAAFLE    211 - 280
EGPEENSAYEQLLSRLEEIAEEGSETQVPGLDISALLPSDFSRYFQYEGSLTTPPCAQGVIWTVFNQTVM    281 - 350
LSAKQLHTLSDTLWGPGDSRLQLNFRATQPLNGRVIEASFPAGVDSSPRAAEPVQLNSCLAAGDILALVF    351 - 420
GLLFAVTSVAFLVQMRRQHRRGTKGGVSYRPAEVAETGA                                   421 - 459
//

Text Mined References (238)

PMID Year Title
26871637 2016 Widespread Expansion of Protein Interaction Capabilities by Alternative Splicing.
26794023 2016 Intrinsic thermodynamics of inhibitor binding to human carbonic anhydrase IX.
26648580 2016 CA IX is upregulated in CoCl2-induced hypoxia and associated with cell invasive potential and a poor prognosis of breast cancer.
26648507 2016 Characteristics of carbonic anhydrase 9 expressing cells in human intestinal crypt base.
26553365 2016 Carbonic Anhydrase 9 mRNA/microRNA34a Interplay in Hypoxic Human Mammospheres.
26522624 2015 Efficient Expression and Crystallization System of Cancer-Associated Carbonic Anhydrase Isoform IX.
26510737 2016 Influence of hypoxia-dependent factors on the progression of neuroblastoma.
26337752 2015 Hypoxia-induced carbonic anhydrase IX facilitates lactate flux in human breast cancer cells by non-catalytic function.
26259239 2015 Evaluation of carbonic anhydrase IX as a therapeutic target for inhibition of breast cancer invasion and metastasis using a series of in vitro breast cancer models.
26252502 2015 Inhibition of carbonic anhydrase IX (CA9) sensitizes renal cell carcinoma to ionizing radiation.
More...