Property Summary

Ligand Count 2,402
NCBI Gene PubMed Count 249
PubMed Score 1024.21
PubTator Score 820.22

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Gene RIF (231)

AA Sequence

MAPLCPSPWLPLLIPAPAPGLTVQLLLSLLLLVPVHPQRLPRMQEDSPLGGGSSGEDDPLGEEDLPSEED      1 - 70
SPREEDPPGEEDLPGEEDLPGEEDLPEVKPKSEEEGSLKLEDLPTVEAPGDPQEPQNNAHRDKEGDDQSH     71 - 140
WRYGGDPPWPRVSPACAGRFQSPVDIRPQLAAFCPALRPLELLGFQLPPLPELRLRNNGHSVQLTLPPGL    141 - 210
EMALGPGREYRALQLHLHWGAAGRPGSEHTVEGHRFPAEIHVVHLSTAFARVDEALGRPGGLAVLAAFLE    211 - 280
EGPEENSAYEQLLSRLEEIAEEGSETQVPGLDISALLPSDFSRYFQYEGSLTTPPCAQGVIWTVFNQTVM    281 - 350
LSAKQLHTLSDTLWGPGDSRLQLNFRATQPLNGRVIEASFPAGVDSSPRAAEPVQLNSCLAAGDILALVF    351 - 420
GLLFAVTSVAFLVQMRRQHRRGTKGGVSYRPAEVAETGA                                   421 - 459
//

Text Mined References (257)

PMID Year Title