Property Summary

NCBI Gene PubMed Count 39
PubMed Score 994.67
PubTator Score 2.50

Knowledge Summary

Patent

No data available

Expression

 GO Process (1)

Gene RIF (17)

AA Sequence

MSGRGKQGGKARAKAKSRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYMAAVLEYLTAEILELAGNA      1 - 70
ARDNKKTRIIPRHLQLAIRNDEELNKLLGKVTIAQGGVLPNIQAVLLPKKTESHKAKSK                71 - 129
//

Text Mined References (54)

PMID Year Title