Property Summary

NCBI Gene PubMed Count 38
Grant Count 396
R01 Count 263
Funding $41,793,730.29
PubMed Score 1007.35
PubTator Score 2.50

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession Q16777 Q6DRA7 Q8IUE5
Symbols H2A
H2A/q
H2AFQ
H2A-GL101

Gene

 GO Function (1)

 GO Process (1)

Gene RIF (17)

PMID Text
25065453 Glycated-H2A histone is better bound by serum anti-DNA autoantibodies in systemic lupus erythematosus patients, and could be a likely trigger for the disease.
22334663 Our results provide mechanistic insight into how post-translational modification of H2A at the site of a photolesion initiates the repair process and directly affects the stability of the human genome.
21633354 Aurora-B-dependent phosphorylation of condensin promotes its association with histone H2A and H2A.Z, which we identify as conserved chromatin 'receptors' of condensin
21596310 L3MBTL2-specific RNAi resulted in increased expression of target genes that exhibited a significant reduction in H2A lysine 119 monoubiquitination.
20838438 AT1R modify the composition of histone H2A and post-translational modifications.
20599239 HIV-1 Tat activated transcription facilitates removal of histones H2A and H2B at the LTR, and the FACT complex, at least consisting of SPT16 and SSRP1, may be responsible for their removal
19667409 Results demonstrate the potential of C-terminal truncated H2A to contribute to the process of carcinogenesis through epigenetic mechanisms.
19500350 Study demonstrated that RNF168 is endowed with ubiquitin ligase activity both in vitro and in vivo, which targets histones H2A and H2AX, but not H2B, forming K63 polyubiquitin chains.
19385636 The change in nucleosome core particle conformation induced by global histone acetylation is dependent on H2A/H2A.Z acetylation.
18593899 DDB1-CUL4B(DDB2) is more efficient than DDB1-CUL4A(DDB2) in monoubiquitinating histone H2A in vitro.
More...

AA Sequence

MSGRGKQGGKARAKAKSRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYMAAVLEYLTAEILELAGNA      1 - 70
ARDNKKTRIIPRHLQLAIRNDEELNKLLGKVTIAQGGVLPNIQAVLLPKKTESHKAKSK                71 - 129
//

Text Mined References (49)

PMID Year Title
25470042 2014 TRIM37 is a new histone H2A ubiquitin ligase and breast cancer oncoprotein.
25362550 2015 A comprehensive view of the epigenetic landscape part I: DNA methylation, passive and active DNA demethylation pathways and histone variants.
25065453 2015 Glycated-H2A histone is better bound by serum anti-DNA autoantibodies in SLE patients: glycated-histones as likely trigger for SLE?
24352239 2014 Glutamine methylation in histone H2A is an RNA-polymerase-I-dedicated modification.
24140421 2013 VprBP has intrinsic kinase activity targeting histone H2A and represses gene transcription.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
22980979 2012 RNF168 ubiquitinates K13-15 on H2A/H2AX to drive DNA damage signaling.
22713238 2012 A novel ubiquitin mark at the N-terminal tail of histone H2As targeted by RNF168 ubiquitin ligase.
22334663 2012 Monoubiquitinated histone H2A destabilizes photolesion-containing nucleosomes with concomitant release of UV-damaged DNA-binding protein E3 ligase.
21925322 2011 Identification of 67 histone marks and histone lysine crotonylation as a new type of histone modification.
More...