Property Summary

NCBI Gene PubMed Count 30
PubMed Score 78.32
PubTator Score 115.28

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
lung carcinoma 2844 3.38091141161026E-23
atypical teratoid / rhabdoid tumor 4369 3.7408540462023E-8
medulloblastoma, large-cell 6234 1.95329080963585E-6
adult high grade glioma 2148 6.91769468101341E-6
osteosarcoma 7933 9.03963997807907E-6
pilocytic astrocytoma 3086 1.01053944761251E-5
ovarian cancer 8492 4.74521684485041E-5
medulloblastoma 1524 1.31196299714622E-4
glioblastoma 5572 1.68175933471975E-4
pancreatic ductal adenocarcinoma liver metastasis 1795 0.00185059111829318
primitive neuroectodermal tumor 3031 0.00364027076468564
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.0100638795826316
astrocytic glioma 2241 0.010504517438879
ependymoma 2514 0.0239993707415884
non primary Sjogren syndrome sicca 840 0.0370078174930467
Disease Target Count Z-score Confidence
membranoproliferative glomerulonephritis 8 3.059 1.5

Expression

  Differential Expression (15)

Synonym

Accession Q16775 A8K290 B4DP33 B4DRA7 E7EN93
Symbols GLO2
GLX2
GLXII
HAGH1

Gene

PANTHER Protein Class (1)

PDB

1QH3   1QH5   2F50  

  Ortholog (13)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Opossum OMA EggNOG Inparanoid
Platypus OMA EggNOG Inparanoid
Chicken OMA EggNOG Inparanoid
Anole lizard OMA EggNOG
Xenopus OMA EggNOG Inparanoid
C. elegans OMA EggNOG
S.cerevisiae OMA EggNOG

Gene RIF (10)

PMID Text
26552067 Studies indicate that the most extensively investigated The most extensively investigated glyoxalase enzymes are glyoxalase I and glyoxalase II (Glo1 and Glo2).
25645869 This study suggested that HAGH, rs11859266 and rs3743852 showed significant associations with schizophrenia in males at allelic and genotype levels.
24671236 No association between genetic variants of the HAGH gene and autism spectrum disorder was found.
20877624 Observational study of gene-disease association. (HuGE Navigator)
20237496 Observational study of gene-disease association. (HuGE Navigator)
19413286 Human glyoxalase II contains an Fe(II)Zn(II) center but is active as a mononuclear Zn(II) enzyme
18344682 In androgen-dependent prostate cancer cells, testosterone upregulates GLO2 mRNA levels. In androgen-independent prostate cancer cells, it downregulates GLO2 mRNA.
16831876 Data show that the GLX2 gene, which encodes glyoxalase II enzyme, is up-regulated by p63 and p73.
16803681 Overexpression of glyoxalase II is associated with kidney tumor
15117945 hydroxyacylglutathione hydrolase (HAGH) gene encodes both cytosolic and mitochondrial forms of glyoxalase II

AA Sequence

MVVGRGLLGRRSLAALGAACARRGLGPALLGVFCHTDLRKNLTVDEGTMKVEVLPALTDNYMYLVIDDET      1 - 70
KEAAIVDPVQPQKVVDAARKHGVKLTTVLTTHHHWDHAGGNEKLVKLESGLKVYGGDDRIGALTHKITHL     71 - 140
STLQVGSLNVKCLATPCHTSGHICYFVSKPGGSEPPAVFTGDTLFVAGCGKFYEGTADEMCKALLEVLGR    141 - 210
LPPDTRVYCGHEYTINNLKFARHVEPGNAAIREKLAWAKEKYSIGEPTVPSTLAEEFTYNPFMRVREKTV    211 - 280
QQHAGETDPVTTMRAVRREKDQFKMPRD                                              281 - 308
//

Text Mined References (34)

PMID Year Title
26552067 2015 Glyoxalase biochemistry.
25645869 2015 Genetic analysis of the glyoxalase system in schizophrenia.
24671236 2015 Weak association of glyoxalase 1 (GLO1) variants with autism spectrum disorder.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
21269460 2011 Initial characterization of the human central proteome.
21044950 2011 Genome-wide YFP fluorescence complementation screen identifies new regulators for telomere signaling in human cells.
20877624 2010 Genetic variants in nuclear-encoded mitochondrial genes influence AIDS progression.
20237496 2010 New genetic associations detected in a host response study to hepatitis B vaccine.
19608861 2009 Lysine acetylation targets protein complexes and co-regulates major cellular functions.
More...