Property Summary

NCBI Gene PubMed Count 30
Grant Count 10
R01 Count 9
Funding $950,147.25
PubMed Score 78.32
PubTator Score 115.28

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (15)

Gene RIF (10)

PMID Text
26552067 Studies indicate that the most extensively investigated The most extensively investigated glyoxalase enzymes are glyoxalase I and glyoxalase II (Glo1 and Glo2).
25645869 This study suggested that HAGH, rs11859266 and rs3743852 showed significant associations with schizophrenia in males at allelic and genotype levels.
24671236 No association between genetic variants of the HAGH gene and autism spectrum disorder was found.
20877624 Observational study of gene-disease association. (HuGE Navigator)
20237496 Observational study of gene-disease association. (HuGE Navigator)
19413286 Human glyoxalase II contains an Fe(II)Zn(II) center but is active as a mononuclear Zn(II) enzyme
18344682 In androgen-dependent prostate cancer cells, testosterone upregulates GLO2 mRNA levels. In androgen-independent prostate cancer cells, it downregulates GLO2 mRNA.
16831876 Data show that the GLX2 gene, which encodes glyoxalase II enzyme, is up-regulated by p63 and p73.
16803681 Overexpression of glyoxalase II is associated with kidney tumor
15117945 hydroxyacylglutathione hydrolase (HAGH) gene encodes both cytosolic and mitochondrial forms of glyoxalase II

AA Sequence

MVVGRGLLGRRSLAALGAACARRGLGPALLGVFCHTDLRKNLTVDEGTMKVEVLPALTDNYMYLVIDDET      1 - 70
KEAAIVDPVQPQKVVDAARKHGVKLTTVLTTHHHWDHAGGNEKLVKLESGLKVYGGDDRIGALTHKITHL     71 - 140
STLQVGSLNVKCLATPCHTSGHICYFVSKPGGSEPPAVFTGDTLFVAGCGKFYEGTADEMCKALLEVLGR    141 - 210
LPPDTRVYCGHEYTINNLKFARHVEPGNAAIREKLAWAKEKYSIGEPTVPSTLAEEFTYNPFMRVREKTV    211 - 280
QQHAGETDPVTTMRAVRREKDQFKMPRD                                              281 - 308
//

Text Mined References (34)

PMID Year Title
26552067 2015 Glyoxalase biochemistry.
25645869 2015 Genetic analysis of the glyoxalase system in schizophrenia.
24671236 2015 Weak association of glyoxalase 1 (GLO1) variants with autism spectrum disorder.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
21269460 2011 Initial characterization of the human central proteome.
21044950 2011 Genome-wide YFP fluorescence complementation screen identifies new regulators for telomere signaling in human cells.
20877624 2010 Genetic variants in nuclear-encoded mitochondrial genes influence AIDS progression.
20237496 2010 New genetic associations detected in a host response study to hepatitis B vaccine.
19608861 2009 Lysine acetylation targets protein complexes and co-regulates major cellular functions.
More...