Property Summary

NCBI Gene PubMed Count 32
PubMed Score 82.59
PubTator Score 115.28

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (15)

Disease log2 FC p
adult high grade glioma -1.600 6.9e-06
astrocytic glioma -1.300 1.1e-02
Astrocytoma, Pilocytic -1.100 8.4e-06
atypical teratoid / rhabdoid tumor -1.600 3.7e-08
ependymoma -1.400 2.4e-02
glioblastoma -1.200 3.3e-07
intraductal papillary-mucinous neoplasm ... -1.100 1.0e-02
lung carcinoma 1.100 3.4e-23
medulloblastoma -1.100 1.3e-04
medulloblastoma, large-cell -1.400 2.0e-06
non primary Sjogren syndrome sicca 1.100 3.7e-02
osteosarcoma -3.214 9.0e-06
ovarian cancer 1.500 4.7e-05
pancreatic ductal adenocarcinoma liver m... -1.766 1.9e-03
primitive neuroectodermal tumor -1.200 3.6e-03

Gene RIF (12)

AA Sequence

MVVGRGLLGRRSLAALGAACARRGLGPALLGVFCHTDLRKNLTVDEGTMKVEVLPALTDNYMYLVIDDET      1 - 70
KEAAIVDPVQPQKVVDAARKHGVKLTTVLTTHHHWDHAGGNEKLVKLESGLKVYGGDDRIGALTHKITHL     71 - 140
STLQVGSLNVKCLATPCHTSGHICYFVSKPGGSEPPAVFTGDTLFVAGCGKFYEGTADEMCKALLEVLGR    141 - 210
LPPDTRVYCGHEYTINNLKFARHVEPGNAAIREKLAWAKEKYSIGEPTVPSTLAEEFTYNPFMRVREKTV    211 - 280
QQHAGETDPVTTMRAVRREKDQFKMPRD                                              281 - 308
//

Text Mined References (36)

PMID Year Title