Property Summary

NCBI Gene PubMed Count 11
PubMed Score 157.84
PubTator Score 17.86

Knowledge Summary

Patent (13,033)

Expression

  Differential Expression (10)

Disease log2 FC p
astrocytoma -2.000 1.2e-03
Breast cancer 1.300 1.4e-06
diabetes mellitus 2.800 1.8e-03
mucosa-associated lymphoid tissue lympho... 1.025 1.0e-02
Multiple myeloma 1.368 2.0e-03
ovarian cancer 2.900 5.0e-07
pancreatic cancer 1.200 1.1e-02
Pick disease -1.100 6.7e-06
primary pancreatic ductal adenocarcinoma 1.236 7.6e-03
Subcutaneous panniculitis-like T-cell ly... 1.100 4.8e-02

 GWAS Trait (1)

Protein-protein Interaction (1)

Gene RIF (1)

AA Sequence

MSGPRPVVLSGPSGAGKSTLLKRLLQEHSGIFGFSVSHTTRNPRPGEENGKDYYFVTREVMQRDIAAGDF      1 - 70
IEHAEFSGNLYGTSKVAVQAVQAMNRICVLDVDLQGVRNIKATDLRPIYISVQPPSLHVLEQRLRQRNTE     71 - 140
TEESLVKRLAAAQADMESSKEPGLFDVVIINDSLDQAYAELKEALSEEIKKAQRTGA                 141 - 197
//

Text Mined References (17)

PMID Year Title