Property Summary

NCBI Gene PubMed Count 25
PubMed Score 66.28
PubTator Score 77.17

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.6
Kidney Neoplasms 37 0.0 0.0
Disease Target Count P-value
interstitial cystitis 2312 1.2e-03
uncontrolled asthma 56 8.3e-03
Disease Target Count Z-score Confidence
Huntington's disease 76 3.01 1.5

Expression

  Differential Expression (2)

Disease log2 FC p
interstitial cystitis -1.200 1.2e-03
uncontrolled asthma 1.200 8.3e-03

Synonym

Accession Q16773 Q5T275 Q8N191
Symbols GTK
KAT1
KATI
CCBL1

Gene

PANTHER Protein Class (2)

PDB

1W7L   1W7M   1W7N   3FVS   3FVU   3FVX   4WLH   4WLJ   4WP0  

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

 GO Component (2)

Protein-protein Interaction (4)

Gene RIF (4)

AA Sequence

MAKQLQARRLDGIDYNPWVEFVKLASEHDVVNLGQGFPDFPPPDFAVEAFQHAVSGDFMLNQYTKTFGYP      1 - 70
PLTKILASFFGELLGQEIDPLRNVLVTVGGYGALFTAFQALVDEGDEVIIIEPFFDCYEPMTMMAGGRPV     71 - 140
FVSLKPGPIQNGELGSSSNWQLDPMELAGKFTSRTKALVLNTPNNPLGKVFSREELELVASLCQQHDVVC    141 - 210
ITDEVYQWMVYDGHQHISIASLPGMWERTLTIGSAGKTFSATGWKVGWVLGPDHIMKHLRTVHQNSVFHC    211 - 280
PTQSQAAVAESFEREQLLFRQPSSYFVQFPQAMQRCRDHMIRSLQSVGLKPIIPQGSYFLITDISDFKRK    281 - 350
MPDLPGAVDEPYDRRFVKWMIKNKGLVAIPVSIFYSVPHQKHFDHYIRFCFVKDEATLQAMDEKLRKWKV    351 - 420
EL                                                                        421 - 422
//

Text Mined References (25)

PMID Year Title