Property Summary

Ligand Count 1
NCBI Gene PubMed Count 25
PubMed Score 66.28
PubTator Score 77.17

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.6
Kidney Neoplasms 37 0.0 0.0
Disease Target Count P-value
interstitial cystitis 2312 1.2e-03
uncontrolled asthma 56 8.3e-03
Disease Target Count Z-score Confidence
Huntington's disease 76 3.01 1.5

Expression

  Differential Expression (2)

Disease log2 FC p
interstitial cystitis -1.200 1.2e-03
uncontrolled asthma 1.200 8.3e-03

 GO Component (2)

Protein-protein Interaction (4)

Gene RIF (4)

AA Sequence

MAKQLQARRLDGIDYNPWVEFVKLASEHDVVNLGQGFPDFPPPDFAVEAFQHAVSGDFMLNQYTKTFGYP      1 - 70
PLTKILASFFGELLGQEIDPLRNVLVTVGGYGALFTAFQALVDEGDEVIIIEPFFDCYEPMTMMAGGRPV     71 - 140
FVSLKPGPIQNGELGSSSNWQLDPMELAGKFTSRTKALVLNTPNNPLGKVFSREELELVASLCQQHDVVC    141 - 210
ITDEVYQWMVYDGHQHISIASLPGMWERTLTIGSAGKTFSATGWKVGWVLGPDHIMKHLRTVHQNSVFHC    211 - 280
PTQSQAAVAESFEREQLLFRQPSSYFVQFPQAMQRCRDHMIRSLQSVGLKPIIPQGSYFLITDISDFKRK    281 - 350
MPDLPGAVDEPYDRRFVKWMIKNKGLVAIPVSIFYSVPHQKHFDHYIRFCFVKDEATLQAMDEKLRKWKV    351 - 420
EL                                                                        421 - 422
//

Text Mined References (25)

PMID Year Title