Property Summary

NCBI Gene PubMed Count 25
Grant Count 1
R01 Count 1
Funding $63,436
PubMed Score 65.52
PubTator Score 77.17

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (2)

Disease log2 FC p
uncontrolled asthma 1.200 0.008
interstitial cystitis -1.300 0.000

Synonym

Accession Q16773 Q5T275 Q8N191
Symbols GTK
KAT1
KATI
CCBL1

Gene

PANTHER Protein Class (2)

 Grant Application (1)

PDB

1W7L   1W7M   1W7N   3FVS   3FVU   3FVX   4WLH   4WLJ   4WP0  

Gene RIF (4)

PMID Text
22093698 CH(3)Hg-S-Cys and Cys-S-Hg-S-Cys are substrates and reversible inhibitors of GTK.
18342615 alpha-keto acids generated by transamination/l-amino acid oxidase activity of the two catechol cysteine S-conjugates are unstable
16828464 We found elevated cerebellar KAT-1 activities in post-mortem brain samples from schizophrenic versus normal individuals.
15016471 major biological roles of glutamine transaminase K are to maintain low levels of phenylpyruvate and to close the methionine salvage pathway--REVIEW

AA Sequence

MAKQLQARRLDGIDYNPWVEFVKLASEHDVVNLGQGFPDFPPPDFAVEAFQHAVSGDFMLNQYTKTFGYP      1 - 70
PLTKILASFFGELLGQEIDPLRNVLVTVGGYGALFTAFQALVDEGDEVIIIEPFFDCYEPMTMMAGGRPV     71 - 140
FVSLKPGPIQNGELGSSSNWQLDPMELAGKFTSRTKALVLNTPNNPLGKVFSREELELVASLCQQHDVVC    141 - 210
ITDEVYQWMVYDGHQHISIASLPGMWERTLTIGSAGKTFSATGWKVGWVLGPDHIMKHLRTVHQNSVFHC    211 - 280
PTQSQAAVAESFEREQLLFRQPSSYFVQFPQAMQRCRDHMIRSLQSVGLKPIIPQGSYFLITDISDFKRK    281 - 350
MPDLPGAVDEPYDRRFVKWMIKNKGLVAIPVSIFYSVPHQKHFDHYIRFCFVKDEATLQAMDEKLRKWKV    351 - 420
EL                                                                        421 - 422
//

Text Mined References (25)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
24816252 2014 An atlas of genetic influences on human blood metabolites.
22093698 2012 New insights into the metabolism of organomercury compounds: mercury-containing cysteine S-conjugates are substrates of human glutamine transaminase K and potent inactivators of cystathionine ?-lyase.
19338303 2009 Structural insight into the inhibition of human kynurenine aminotransferase I/glutamine transaminase K.
18342615 2008 Substrate specificity of human glutamine transaminase K as an aminotransferase and as a cysteine S-conjugate beta-lyase.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
16828464 2006 Preliminary evidence for a link between schizophrenia and NMDA-glycine site receptor ligand metabolic enzymes, d-amino acid oxidase (DAAO) and kynurenine aminotransferase-1 (KAT-1).
16463021 2006 Cysteine S-conjugate beta-lyases.
16376499 2006 Characterization of kynurenine aminotransferase III, a novel member of a phylogenetically conserved KAT family.
More...