Property Summary

NCBI Gene PubMed Count 22
PubMed Score 30.33
PubTator Score 41.79

Knowledge Summary

Patent

No data available

Expression

Gene RIF (13)

AA Sequence

MAGKPKLHYFNGRGRMEPIRWLLAAAGVEFEEKFIGSAEDLGKLRNDGSLMFQQVPMVEIDGMKLVQTRA      1 - 70
ILNYIASKYNLYGKDIKERALIDMYTEGMADLNEMILLLPLCRPEEKDAKIALIKEKTKSRYFPAFEKVL     71 - 140
QSHGQDYLVGNKLSRADISLVELLYYVEELDSSLISNFPLLKALKTRISNLPTVKKFLQPGSPRKPPADA    141 - 210
KALEEARKIFRF                                                              211 - 222
//

Text Mined References (22)

PMID Year Title