Property Summary

NCBI Gene PubMed Count 21
Grant Count 14
R01 Count 11
Funding $1,531,659.21
PubMed Score 27.18
PubTator Score 41.79

Knowledge Summary

Patent

No data available

Expression

Gene RIF (12)

PMID Text
25248748 analysis of how isomerization of the steroid Delta(5)-androstene-3,17-dione by the glutathione transferase A3-3
24739064 Density functional theory calculations used to propose a refined mechanism for the isomerization of delta(5)-androstene-3,17-dione catalyzed by GST A3-3
23650189 Data indicate that steroidogenic factor 1 (SF-1) and glutathione S-transferase A (GSTA) family genes (hGSTA1-hGSTA4) are involved in steroidogenesis.
20237496 Observational study of gene-disease association. (HuGE Navigator)
20200426 Observational study of gene-disease association. (HuGE Navigator)
20083122 The 3D structures of human GSTs A2-2 and A3-3 in complex with Delta(4)-androstene-3-17-dione, were solved.
19343046 Observational study of gene-disease association. (HuGE Navigator)
18977241 Observational study of gene-disease association. (HuGE Navigator)
18426392 Significantly contributes to the double-bond isomerization necessary for steroid hormone biosynthesis in complex systems, thereby complementing the indispensable 3beta-hydroxysteroid oxidoreductase activity of 3beta-hydroxysteroid dehydrogenase.
17601350 Observational study of gene-disease association. (HuGE Navigator)
More...

AA Sequence

MAGKPKLHYFNGRGRMEPIRWLLAAAGVEFEEKFIGSAEDLGKLRNDGSLMFQQVPMVEIDGMKLVQTRA      1 - 70
ILNYIASKYNLYGKDIKERALIDMYTEGMADLNEMILLLPLCRPEEKDAKIALIKEKTKSRYFPAFEKVL     71 - 140
QSHGQDYLVGNKLSRADISLVELLYYVEELDSSLISNFPLLKALKTRISNLPTVKKFLQPGSPRKPPADA    141 - 210
KALEEARKIFRF                                                              211 - 222
//

Text Mined References (21)

PMID Year Title
25248748 2014 The isomerization of ?5-androstene-3,17-dione by the human glutathione transferase A3-3 proceeds via a conjugated heteroannular diene intermediate.
24739064 2014 Isomerization of ?5-androstene-3,17-dione into ?4-androstene-3,17-dione catalyzed by human glutathione transferase A3-3: a computational study identifies a dual role for glutathione.
23650189 2013 Human glutathione S-transferase A (GSTA) family genes are regulated by steroidogenic factor 1 (SF-1) and are involved in steroidogenesis.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
20237496 2010 New genetic associations detected in a host response study to hepatitis B vaccine.
20200426 2010 Glutathione pathway genetic polymorphisms and lung cancer survival after platinum-based chemotherapy.
20083122 2010 Structural basis for featuring of steroid isomerase activity in alpha class glutathione transferases.
19343046 2009 Association study between single-nucleotide polymorphisms in 199 drug-related genes and commonly measured quantitative traits of 752 healthy Japanese subjects.
18977241 2008 Oxidative stress, telomere length and biomarkers of physical aging in a cohort aged 79 years from the 1932 Scottish Mental Survey.
18426392 2008 Targeting human glutathione transferase A3-3 attenuates progesterone production in human steroidogenic cells.
More...