Property Summary

NCBI Gene PubMed Count 30
Grant Count 18
R01 Count 13
Funding $1,707,247.94
PubMed Score 132.55
PubTator Score 59.27

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (13)

Disease log2 FC p
astrocytic glioma -3.100 0.007
ependymoma -2.500 0.039
oligodendroglioma -2.100 0.040
psoriasis -1.100 0.008
sonic hedgehog group medulloblastoma -1.400 0.031
medulloblastoma, large-cell -1.800 0.009
lung cancer 2.500 0.000
sarcoidosis 2.200 0.048
lung adenocarcinoma 1.433 0.017
gastric carcinoma 1.300 0.046
mucosa-associated lymphoid tissue lympho... 1.596 0.011
ulcerative colitis 1.100 0.010
Breast cancer 1.500 0.001

Gene RIF (20)

PMID Text
24164736 observations provide evidence for an involvement of QC in Alzheimer's disease pathogenesis and cognitive decline by QC-catalyzed pGlu-Abeta formation
23207485 this study demonistrated that QPCT mRNAand protein from mononuclear cells correlated with theseverity of dementia.
23183267 Upregulation of QPCT expression is associated with thyroid carcinomas.
21671571 This study presents a first comparison of two mammalian QCs (human and mouse) containing typical, conserved post-translational modifications.
21301857 The resilts of this studt provided histopathological evidence for QC being a prerequisite for pE-Abeta pathology in vivo and further underline the therapeutic potential of QC inhibition in Alzheimer Disease.
21288892 Upon binding to PBD150, a large loop movement in gQC allows the inhibitor to be tightly held in its active site primarily by hydrophobic interactions.
20383514 This study demonstrated that glutaminyl cyclase expression and pE-Abeta formation in subcortical brain regions( Edinger-Westphal nucleus, locus coeruleus and nucleus basalis Meynert) affected in Alzheimer's disease.
19804409 Human isoQC proteins displayed a broad substrate specificity and preference for hydrophobic substrates, similar to the related QC.
18486145 Golgi apparatus retention implies a "housekeeping" protein maturation machinery conducting glycosylation and pyroglutamyl formation. For these isoenzymes, apparently similar strategies evolved to retain the proteins in the Golgi complex.
18470930 The computations outline the important role of Trp329 in helping the substrate binding process and stabilizing the cyclization transition state.
More...

AA Sequence

MAGGRHRRVVGTLHLLLLVAALPWASRGVSPSASAWPEEKNYHQPAILNSSALRQIAEGTSISEMWQNDL      1 - 70
QPLLIERYPGSPGSYAARQHIMQRIQRLQADWVLEIDTFLSQTPYGYRSFSNIISTLNPTAKRHLVLACH     71 - 140
YDSKYFSHWNNRVFVGATDSAVPCAMMLELARALDKKLLSLKTVSDSKPDLSLQLIFFDGEEAFLHWSPQ    141 - 210
DSLYGSRHLAAKMASTPHPPGARGTSQLHGMDLLVLLDLIGAPNPTFPNFFPNSARWFERLQAIEHELHE    211 - 280
LGLLKDHSLEGRYFQNYSYGGVIQDDHIPFLRRGVPVLHLIPSPFPEVWHTMDDNEENLDESTIDNLNKI    281 - 350
LQVFVLEYLHL                                                               351 - 361
//

Text Mined References (33)

PMID Year Title
24292274 2014 A genome-wide association study identifies multiple susceptibility loci for chronic lymphocytic leukemia.
24164736 2014 Glutaminyl cyclase in human cortex: correlation with (pGlu)-amyloid-? load and cognitive decline in Alzheimer's disease.
23974872 2013 Genome-wide association analysis identifies 13 new risk loci for schizophrenia.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23207485 2013 Increased glutaminyl cyclase expression in peripheral blood of Alzheimer's disease patients.
23183267 2013 Role of glutaminyl cyclases in thyroid carcinomas.
22569225 2012 Investigation of single nucleotide polymorphisms and biological pathways associated with response to TNF? inhibitors in patients with rheumatoid arthritis.
21671571 2011 Structures of glycosylated mammalian glutaminyl cyclases reveal conformational variability near the active center.
21666788 2011 Effects of chronic ascariasis and trichuriasis on cytokine production and gene expression in human blood: a cross-sectional study.
More...