Property Summary

NCBI Gene PubMed Count 17
Grant Count 89
R01 Count 56
Funding $6,822,197.04
PubMed Score 156.21
PubTator Score 24.04

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (1)

Disease log2 FC p
psoriasis 1.100 0.000

Synonym

Accession Q16763 Q9BTC1
Symbols EPF5
E2EPF
E2-EPF

Gene

PDB

5BNB   1ZDN  

Gene RIF (9)

PMID Text
24813613 Study identified APC/C substrates, including the kinase Nek2A, that require Ube2S for degradation. The reconstitution of Nek2A-ubiquitylation revealed that Ube2S does not simply extend a conjugate but instead branches multiple K11-linked chains off the assemblies produced by Ube2C.
22895574 E2-EPF is overexpressed in cervical cancer and associates with tumor growth
21376237 Linkage-specific ubiquitin chain formation by Ube2S is the result of substrate-assisted catalysis.
21281817 These findings reveal deregulation of the oxygen-sensing pathway impinging on the positive feedback mechanism of HIF1-mediated regulation of E2-EPF in papillary renal cell carcinoma.
20080579 K11 specificity is determined by an E2 enzyme, UBE2S/E2-EPF, that elongates ubiquitin chains after the substrates are pre-ubiquitinated by UbcH10 or UbcH5.
19822757 UbcH10 and Ube2S constitute a physiological E2-module for anaphase-promoting complex, the activity of which is required for spindle assembly and cell division.
19820702 UBE2S functions with the APC/C in a two-step mechanism to control substrate ubiquitylation that is essential for mitotic exit after prolonged SAC activation, providing a new model for APC/C function in human cells
19083192 Results suggest that UCP was significantly associated with poor prognosis of esophageal cancer and may be a new molecular target for therapeutic intervention for esophageal squamous cell carcinoma.
18780286 E2-EPF UCP expression induced by growth factors or serum increased HIF-1alpha protein level under non-hypoxic conditions, suggesting that the Egr-1/SRF-UCP-VHL pathway is in part responsible for the increased HIF-1alpha protein level

AA Sequence

MNSNVENLPPHIIRLVYKEVTTLTADPPDGIKVFPNEEDLTDLQVTIEGPEGTPYAGGLFRMKLLLGKDF      1 - 70
PASPPKGYFLTKIFHPNVGANGEICVNVLKRDWTAELGIRHVLLTIKCLLIHPNPESALNEEAGRLLLEN     71 - 140
YEEYAARARLLTEIHGGAGGPSGRAEAGRALASGTEASSTDPGAPGGPGGAEGPMAKKHAGERDKKLAAK    141 - 210
KKTDKKRALRRL                                                              211 - 222
//

Text Mined References (23)

PMID Year Title
24813613 2014 Enhanced protein degradation by branched ubiquitin chains.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22895574 2012 The ubiquitin-conjugating enzyme E2-EPF is overexpressed in cervical cancer and associates with tumor growth.
21376237 2011 The mechanism of linkage-specific ubiquitin chain elongation by a single-subunit E2.
21281817 2011 Deregulation of E2-EPF ubiquitin carrier protein in papillary renal cell carcinoma.
21269460 2011 Initial characterization of the human central proteome.
20622874 2010 Lys11-linked ubiquitin chains adopt compact conformations and are preferentially hydrolyzed by the deubiquitinase Cezanne.
20080579 2010 UBE2S drives elongation of K11-linked ubiquitin chains by the anaphase-promoting complex.
20061386 2010 The E2 ubiquitin-conjugating enzymes direct polyubiquitination to preferred lysines.
19822757 2009 Identification of a physiological E2 module for the human anaphase-promoting complex.
More...