Property Summary

NCBI Gene PubMed Count 43
PubMed Score 231.75
PubTator Score 223.48

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (3)

Disease Target Count P-value
lung carcinoma 2844 5.40308940539972E-20
tuberculosis 1563 6.94792441466907E-10
ovarian cancer 8492 2.98597948774395E-7
pituitary cancer 1972 2.4938134038619E-6
ulcerative colitis 2087 2.50785279475462E-6
malignant mesothelioma 3163 3.84041327475367E-6
osteosarcoma 7933 2.47824914331271E-5
group 4 medulloblastoma 1875 3.07377151642889E-5
interstitial cystitis 2299 7.07196906358488E-5
psoriasis 6685 8.25431827453837E-5
atypical teratoid/rhabdoid tumor 1095 1.34427058962505E-4
intraductal papillary-mucinous adenoma (IPMA) 2956 6.01198491351527E-4
colon cancer 1475 0.00299799056844311
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.00378894177750522
pancreatic ductal adenocarcinoma liver metastasis 1795 0.00488206163629557
medulloblastoma, large-cell 6234 0.0130790104680275
Disease Target Count Z-score Confidence
Toxic shock syndrome 28 6.794 3.4
Staphyloenterotoxemia 20 5.038 2.5
Mastitis 48 4.501 2.3

Expression

  Differential Expression (16)

Synonym

Accession Q16762 B3KRM1 Q6IB06
Symbols RDS

Gene

TST

PANTHER Protein Class (1)

  Ortholog (15)

Species Source
Chimp OMA EggNOG
Macaque OMA Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA EggNOG Inparanoid
Horse OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Pig OMA EggNOG
Opossum OMA EggNOG Inparanoid
Platypus OMA EggNOG
Chicken OMA Inparanoid
Anole lizard OMA Inparanoid
Xenopus OMA EggNOG Inparanoid
C. elegans OMA EggNOG
S.cerevisiae OMA EggNOG Inparanoid

Gene RIF (7)

PMID Text
26269602 show that polymorphic variations that are distant from the active site differentially modulate the sulfurtransferase activity of human rhodanese to cyanide versus sulfite
23399736 Loss of Thiosulfate Sulfurtransferase is associated with decreased mucosal sulfide detoxification capacity in patients with Crohn's disease
20877624 Observational study of gene-disease association. (HuGE Navigator)
20663881 silencing of the rhodanese gene caused not only a proportional decrease of 5 S rRNA import but also a general inhibition of mitochondrial translation, indicating the functional importance of the imported 5 S rRNA inside the organelle.
20099848 Proteomics was used to study colonic epithelial aging, for differential proteins in the human normal colonic epithelial tissues from young and old people. Rack1, EF-Tu and Rhodanese, three validated differential proteins, were further investigated.
17035239 The USP8 recognition domain of NRDP1 has a novel protein fold that interacts with a conserved peptide loop of the rhodanese domain.
15910006 A partially gluconoylated N-terminus of the His6-tagged molybdenum cofactor synthesis 3 (MOCS3)-rhodanese-like domain is identified which results in a heterogeneity of the protein but does not influence sulfurtransferase activity.

AA Sequence

MVHQVLYRALVSTKWLAESIRTGKLGPGLRVLDASWYSPGTREARKEYLERHVPGASFFDIEECRDTASP      1 - 70
YEMMLPSEAGFAEYVGRLGISNHTHVVVYDGEHLGSFYAPRVWWMFRVFGHRTVSVLNGGFRNWLKEGHP     71 - 140
VTSEPSRPEPAVFKATLDRSLLKTYEQVLENLESKRFQLVDSRSQGRFLGTEPEPDAVGLDSGHIRGAVN    141 - 210
MPFMDFLTEDGFEKGPEELRALFQTKKVDLSQPLIATCRKGVTACHVALAAYLCGKPDVAVYDGSWSEWF    211 - 280
RRAPPESRVSQGKSEKA                                                         281 - 297
//

Text Mined References (47)

PMID Year Title
26269602 2015 Polymorphic Variants of Human Rhodanese Exhibit Differences in Thermal Stability and Sulfur Transfer Kinetics.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23580065 2013 Shotgun proteomics reveals specific modulated protein patterns in tears of patients with primary open angle glaucoma naïve to therapy.
23399736 2013 Decreased mucosal sulfide detoxification capacity in patients with Crohn's disease.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
21922874 Assessment of cassava toxicity in patients with tropical chronic pancreatitis.
21685364 2011 Biological significance of 5S rRNA import into human mitochondria: role of ribosomal protein MRP-L18.
21492153 2011 Analysis of proteomic changes induced upon cellular differentiation of the human intestinal cell line Caco-2.
21269460 2011 Initial characterization of the human central proteome.
More...