Property Summary

NCBI Gene PubMed Count 44
PubMed Score 208.64
PubTator Score 223.48

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (16)

Disease log2 FC p
atypical teratoid/rhabdoid tumor -1.100 1.3e-04
colon cancer -1.200 2.1e-02
group 3 medulloblastoma -1.100 1.9e-02
interstitial cystitis -1.200 7.1e-05
intraductal papillary-mucinous adenoma (... 1.100 6.0e-04
intraductal papillary-mucinous neoplasm ... 1.200 3.8e-03
lung carcinoma -1.300 5.4e-20
malignant mesothelioma -1.200 3.8e-06
medulloblastoma, large-cell -1.100 1.3e-02
osteosarcoma -1.883 2.5e-05
ovarian cancer -2.100 3.0e-07
pancreatic ductal adenocarcinoma liver m... -1.468 4.9e-03
pituitary cancer -1.500 2.5e-06
psoriasis 2.300 8.3e-05
tuberculosis 1.700 6.9e-10
ulcerative colitis -1.500 2.5e-06

Gene RIF (8)

AA Sequence

MVHQVLYRALVSTKWLAESIRTGKLGPGLRVLDASWYSPGTREARKEYLERHVPGASFFDIEECRDTASP      1 - 70
YEMMLPSEAGFAEYVGRLGISNHTHVVVYDGEHLGSFYAPRVWWMFRVFGHRTVSVLNGGFRNWLKEGHP     71 - 140
VTSEPSRPEPAVFKATLDRSLLKTYEQVLENLESKRFQLVDSRSQGRFLGTEPEPDAVGLDSGHIRGAVN    141 - 210
MPFMDFLTEDGFEKGPEELRALFQTKKVDLSQPLIATCRKGVTACHVALAAYLCGKPDVAVYDGSWSEWF    211 - 280
RRAPPESRVSQGKSEKA                                                         281 - 297
//

Text Mined References (48)

PMID Year Title