Property Summary

NCBI Gene PubMed Count 23
Grant Count 16
R01 Count 13
Funding $813,224.34
PubMed Score 27.40
PubTator Score 17.58

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (6)

Disease log2 FC p
osteosarcoma -1.377 0.000
non diabetic and post-ischemic heart fai... -1.100 0.026
intraductal papillary-mucinous adenoma (... 1.800 0.000
diabetes mellitus -1.600 0.002
lung carcinoma -1.200 0.000
gastric carcinoma -1.600 0.048

Gene RIF (11)

PMID Text
23184957 Diacylglycerol signaling limits Akt activation through diacylglycerol kinase delta and PHLPP2.
22406787 This study demonistrated that the lack of association of DGKD SNPs with PD in the Han Chinese population.
22082156 Knockdown of diacylglycerol kinase, delta 130kDa (DGKD) by siRNA enhances the early stages of HIV-1 replication in HeLa-CD4 cells infected with viral pseudotypes HIV89.6R and HIV8.2N
20857926 Zinc site mutations impair DGKdelta localization to cytoplasmic puncta and enhance localization the plasma membrane.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20064931 Data indicate a novel mechanism where diacylglycerol kinase delta and protein kinase Calpha modulate the levels of ubiquitinated epidermal growth factor receptors through Akt and ubiquitin-specific protease 8.
18334213 Polymerization of DGK delta regulates the activity of the enzyme by sequestering DGK delta in an inactive cellular location.
18267070 Study identified reduced diacylglycerol kinase delta (DGKdelta) expression and DGK activity in skeletal muscle from type 2 diabetic patients.
17357084 Disruption of diacylglycerol kinase delta (DGKD) is associated with seizures in humans and mice.
15228384 Phosphorylation is involved in the control of subcellular localization of DGKdelta1.
More...

AA Sequence

MAAAAGAPPPGPPQPPPPPPPEESSDSEPEAEPGSPQKLIRKVSTSGQIRQKTIIKEGMLTKQNNSFQRS      1 - 70
KRRYFKLRGRTLYYAKTAKSIIFDEVDLTDASVAESSTKNVNNSFTVITPCRKLILCADNRKEMEDWIAA     71 - 140
LKTVQNREHFEPTQYSMDHFSGMHNWYACSHARPTYCNVCREALSGVTSHGLSCEVCKFKAHKRCAVRAT    141 - 210
NNCKWTTLASIGKDIIEDADGIAMPHQWLEGNLPVSAKCTVCDKTCGSVLRLQDWRCLWCKAMVHTSCKE    211 - 280
SLLTKCPLGLCKVSVIPPTALNSIDSDGFWKASCPPSCTSPLLVFVNSKSGDNQGVKFLRRFKQLLNPAQ    281 - 350
VFDLMNGGPHLGLRLFQKFDTFRILVCGGDGSVGWVLSEIDSLNLHKQCQLGVLPLGTGNDLARVLGWGS    351 - 420
ACDDDTQLPQILEKLERASTKMLDRWSVMAYEAKLPRQASSSTVTEDFSEDSEVQQILFYEDSVAAHLSK    421 - 490
ILTSDQHSVVISSAKVLCETVKDFVARVGKAYEKTTESSEESEVMAKKCSVLKEKLDSLLKTLDDESQAS    491 - 560
SSLPNPPPTIAEEAEDGDGSGSICGSTGDRLVASACPARPQIFRPREQLMLRANSLKKAIRQIIEHTEKA    561 - 630
VDEQNAQTQEQEGFVLGLSESEEKMDHRVCPPLSHSESFGVPKGRSQRKVSKSPCEKLISKGSLSLGSSA    631 - 700
SLPPQPGSRDGLPALNTKILYPNVRAGMSGSLPGGSVISRLLINADPFNSEPETLEYYTEKCVMNNYFGI    701 - 770
GLDAKISLDFNNKRDEHPEKCRSRTKNMMWYGVLGTKELLHRTYKNLEQKVLLECDGRPIPLPSLQGIAV    771 - 840
LNIPSYAGGTNFWGGTKEDDTFAAPSFDDKILEVVAVFGSMQMAVSRVIRLQHHRIAQCRTVKISILGDE    841 - 910
GVPVQVDGEAWVQPPGYIRIVHKNRAQTLTRDRAFESTLKSWEDKQKCELPRPPSCSLHPEMLSEEEATQ    911 - 980
MDQFGQAAGVLIHSIREIAQSHRDMEQELAHAVNASSKSMDRVYGKPRTTEGLNCSFVLEMVNNFRALRS    981 - 1050
ETELLLSGKMALQLDPPQKEQLGSALAEMDRQLRRLADTPWLCQSAEPGDEESVMLDLAKRSRSGKFRLV   1051 - 1120
TKFKKEKNNKNKEAHSSLGAPVHLWGTEEVAAWLEHLSLCEYKDIFTRHDIRGSELLHLERRDLKDLGVT   1121 - 1190
KVGHMKRILCGIKELSRSAPAVEA                                                 1191 - 1214
//

Text Mined References (24)

PMID Year Title
24068962 2013 Meta-analysis of genome-wide association studies identifies six new Loci for serum calcium concentrations.
23414517 2013 A human skeletal muscle interactome centered on proteins involved in muscular dystrophies: LGMD interactome.
23184957 2013 Diacylglycerol kinase ? modulates Akt phosphorylation through pleckstrin homology domain leucine-rich repeat protein phosphatase 2 (PHLPP2).
22412388 2012 A genome-wide scan of Ashkenazi Jewish Crohn's disease suggests novel susceptibility loci.
22406787 Analysis of the genotype of diacylglycerol kinase delta single-nucleotide polymorphisms in Parkinson disease in the Han Chinese population.
20857926 2010 Zinc binding drives sheet formation by the SAM domain of diacylglycerol kinase ?.
20705733 2010 Common variants in the calcium-sensing receptor gene are associated with total serum calcium levels.
20639394 2010 Genome-wide association of serum bilirubin levels in Korean population.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20064931 2010 Diacylglycerol kinase delta and protein kinase C(alpha) modulate epidermal growth factor receptor abundance and degradation through ubiquitin-specific protease 8.
More...