Property Summary

Ligand Count 114
NCBI Gene PubMed Count 42
PubMed Score 128.78
PubTator Score 214.23

Knowledge Summary

Patent

No data available

Expression

Gene RIF (32)

AA Sequence

MALLDLALEGMAVFGFVLFLVLWLMHFMAIIYTRLHLNKKATDKQPYSKLPGVSLLKPLKGVDPNLINNL      1 - 70
ETFFELDYPKYEVLLCVQDHDDPAIDVCKKLLGKYPNVDARLFIGGKKVGINPKINNLMPGYEVAKYDLI     71 - 140
WICDSGIRVIPDTLTDMVNQMTEKVGLVHGLPYVADRQGFAATLEQVYFGTSHPRYYISANVTGFKCVTG    141 - 210
MSCLMRKDVLDQAGGLIAFAQYIAEDYFMAKAIADRGWRFAMSTQVAMQNSGSYSISQFQSRMIRWTKLR    211 - 280
INMLPATIICEPISECFVASLIIGWAAHHVFRWDIMVFFMCHCLAWFIFDYIQLRGVQGGTLCFSKLDYA    281 - 350
VAWFIRESMTIYIFLSALWDPTISWRTGRYRLRCGGTAEEILDV                              351 - 394
//

Text Mined References (44)

PMID Year Title