Property Summary

NCBI Gene PubMed Count 40
Grant Count 110
R01 Count 86
Funding $14,359,150.31
PubMed Score 124.16
PubTator Score 214.23

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession Q16739 Q5T258
Symbols GCS
GLCT1

Gene

PANTHER Protein Class (2)

Gene RIF (30)

PMID Text
25535133 GCS was upregulated in colorectal carcinoma tissues compared to control tissues.
24960545 We found upregulation of specific sphingolipid enzymes, namely sphingomyelin synthase 1 (SMS1), sphingomyelinase 3 (SMPD3), and glucosylceramide synthase (GCS) in the endometrium of endometriotic women.
24510559 Glucosylceramide synthase mRNA were reduced by 62%.
24456584 Our data demonstrates a correlation between the expression of the GCS protein and ER-positive/HER-2 negative breast cancer
24342307 GCS was upregulated in PTCs and might be an independent factor affecting prognosis.
23913449 our work indicates that some UGCG polymorphisms are modifying factors in the severity of GD.
23555901 The results thus show that ARF6 regulates neuronal differentiation through an effect on glucosylceramide synthase and glucosylceramide levels.
23133636 DOX could modulate the expression of GCS through the Sp1 site of GCS promoter in ERalpha-positive breast cancer cells
22936806 Ceramide glycosylation catalyzed by glucosylceramide synthase is important for cancer stem cells in drug resistance and tumorigenesis.
22270805 The authors conclude that hepatitis C virus proteins, especially NS5A and NS5B, have positive effects on the expression of human GlcT-1.
More...

AA Sequence

MALLDLALEGMAVFGFVLFLVLWLMHFMAIIYTRLHLNKKATDKQPYSKLPGVSLLKPLKGVDPNLINNL      1 - 70
ETFFELDYPKYEVLLCVQDHDDPAIDVCKKLLGKYPNVDARLFIGGKKVGINPKINNLMPGYEVAKYDLI     71 - 140
WICDSGIRVIPDTLTDMVNQMTEKVGLVHGLPYVADRQGFAATLEQVYFGTSHPRYYISANVTGFKCVTG    141 - 210
MSCLMRKDVLDQAGGLIAFAQYIAEDYFMAKAIADRGWRFAMSTQVAMQNSGSYSISQFQSRMIRWTKLR    211 - 280
INMLPATIICEPISECFVASLIIGWAAHHVFRWDIMVFFMCHCLAWFIFDYIQLRGVQGGTLCFSKLDYA    281 - 350
VAWFIRESMTIYIFLSALWDPTISWRTGRYRLRCGGTAEEILDV                              351 - 394
//

Text Mined References (42)

PMID Year Title
25535133 2014 Expression and significance of glucosylceramide synthase in colorectal carcinoma tissues.
24960545 2014 Dysregulated sphingolipid metabolism in endometriosis.
24510559 2014 [NF-? B mediates the effect of glucosylceramide synthase on P-glycoprotein modulation in a drug-resistance leukemia cell line].
24456584 2014 Expression of glucosylceramide synthase in invasive ductal breast cancer may be correlated with high estrogen receptor status and low HER-2 status.
24342307 2013 Upregulation of glucosylceramide synthase protein in papillary thyroid carcinoma.
24270810 2013 High-content genome-wide RNAi screens identify regulators of parkin upstream of mitophagy.
23913449 2013 Characterization of variants in the glucosylceramide synthase gene and their association with type 1 Gaucher disease severity.
23555901 2013 ARF6 regulates neuron differentiation through glucosylceramide synthase.
23133636 2012 Doxorubicin influences the expression of glucosylceramide synthase in invasive ductal breast cancer.
22936806 2012 Ceramide glycosylation by glucosylceramide synthase selectively maintains the properties of breast cancer stem cells.
More...