Property Summary

Ligand Count 3
NCBI Gene PubMed Count 19
PubMed Score 39.18
PubTator Score 21.30

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (5)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.8
Disease Target Count Z-score Confidence
Pellagra 26 4.445 2.2

Expression

  Differential Expression (27)

Disease log2 FC p
active Crohn's disease 4.853 3.6e-03
active ulcerative colitis 1.367 3.8e-03
adrenocortical carcinoma -1.621 5.3e-03
adult high grade glioma 1.200 1.4e-02
Astrocytoma, Pilocytic 1.800 2.5e-07
Atopic dermatitis 1.900 3.8e-04
breast carcinoma 1.100 2.4e-07
chronic rhinosinusitis 1.916 2.1e-02
cutaneous lupus erythematosus 2.200 4.8e-03
cystic fibrosis 1.879 1.1e-04
ductal carcinoma in situ 1.200 3.2e-02
glioblastoma 1.300 1.8e-03
intraductal papillary-mucinous adenoma (... 2.000 8.0e-03
intraductal papillary-mucinous neoplasm ... 1.300 2.9e-03
invasive ductal carcinoma 1.300 2.1e-02
lung cancer -1.900 3.9e-03
lung carcinoma -3.200 2.2e-28
malignant mesothelioma -6.700 8.0e-10
mucosa-associated lymphoid tissue lympho... 1.871 2.1e-02
ovarian cancer -1.700 2.0e-03
pancreatic cancer 1.300 2.6e-04
pancreatic ductal adenocarcinoma liver m... -1.249 3.1e-02
posterior fossa group A ependymoma 1.300 2.2e-04
primary Sjogren syndrome 1.800 1.5e-03
psoriasis 2.200 1.5e-12
tuberculosis -1.500 7.4e-06
Waldenstrons macroglobulinemia -1.538 4.6e-02

 GO Component (2)

Gene RIF (7)

AA Sequence

MEPSSLELPADTVQRIAAELKCHPTDERVALHLDEEDKLRHFRECFYIPKIQDLPPVDLSLVNKDENAIY      1 - 70
FLGNSLGLQPKMVKTYLEEELDKWAKIAAYGHEVGKRPWITGDESIVGLMKDIVGANEKEIALMNALTVN     71 - 140
LHLLMLSFFKPTPKRYKILLEAKAFPSDHYAIESQLQLHGLNIEESMRMIKPREGEETLRIEDILEVIEK    141 - 210
EGDSIAVILFSGVHFYTGQHFNIPAITKAGQAKGCYVGFDLAHAVGNVELYLHDWGVDFACWCSYKYLNA    211 - 280
GAGGIAGAFIHEKHAHTIKPALVGWFGHELSTRFKMDNKLQLIPGVCGFRISNPPILLVCSLHASLEIFK    281 - 350
QATMKALRKKSVLLTGYLEYLIKHNYGKDKAATKKPVVNIITPSHVEERGCQLTITFSVPNKDVFQELEK    351 - 420
RGVVCDKRNPNGIRVAPVPLYNSFHDVYKFTNLLTSILDSAETKN                             421 - 465
//

Text Mined References (26)

PMID Year Title