Property Summary

NCBI Gene PubMed Count 18
Grant Count 18
R01 Count 16
Funding $3,151,143.99
PubMed Score 34.90
PubTator Score 21.30

Knowledge Summary

Patent

No data available

Expression

 GWAS Trait (1)

Gene RIF (6)

PMID Text
24667918 Microarray analysis indicates HIV-1 Tat-induced upregulation of kynureninase (KYNU) in primary human brain microvascular endothelial cells
22012986 A rare variant at the KYNU gene is associated with essential hypertension in the Han Chinese population.
20877624 Observational study of gene-disease association. (HuGE Navigator)
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
16080802 The Lys412Glu polymorphism of the KYNU gene in a hypertensive candidate chromosomal region is associated with essential hypertension in Han Chinese.
16080802 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MEPSSLELPADTVQRIAAELKCHPTDERVALHLDEEDKLRHFRECFYIPKIQDLPPVDLSLVNKDENAIY      1 - 70
FLGNSLGLQPKMVKTYLEEELDKWAKIAAYGHEVGKRPWITGDESIVGLMKDIVGANEKEIALMNALTVN     71 - 140
LHLLMLSFFKPTPKRYKILLEAKAFPSDHYAIESQLQLHGLNIEESMRMIKPREGEETLRIEDILEVIEK    141 - 210
EGDSIAVILFSGVHFYTGQHFNIPAITKAGQAKGCYVGFDLAHAVGNVELYLHDWGVDFACWCSYKYLNA    211 - 280
GAGGIAGAFIHEKHAHTIKPALVGWFGHELSTRFKMDNKLQLIPGVCGFRISNPPILLVCSLHASLEIFK    281 - 350
QATMKALRKKSVLLTGYLEYLIKHNYGKDKAATKKPVVNIITPSHVEERGCQLTITFSVPNKDVFQELEK    351 - 420
RGVVCDKRNPNGIRVAPVPLYNSFHDVYKFTNLLTSILDSAETKN                             421 - 465
//

Text Mined References (25)

PMID Year Title
25343990 2015 Genome-wide association study of selenium concentrations.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22012986 2011 A rare variant at the KYNU gene is associated with kynureninase activity and essential hypertension in the Han Chinese population.
21269460 2011 Initial characterization of the human central proteome.
20877624 2010 Genetic variants in nuclear-encoded mitochondrial genes influence AIDS progression.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17334708 2007 Xanthurenic aciduria due to a mutation in KYNU encoding kynureninase.
17300176 2007 Crystal structure of Homo sapiens kynureninase.
More...