Property Summary

NCBI Gene PubMed Count 18
PubMed Score 34.90
PubTator Score 21.30

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (4)

Disease Target Count P-value
lung carcinoma 2844 2.18990864472048E-28
psoriasis 6685 3.43811249755151E-16
ulcerative colitis 2087 9.00356230135467E-13
malignant mesothelioma 3163 3.85122583046562E-9
pilocytic astrocytoma 3086 1.73956790678068E-7
breast carcinoma 1614 2.36361100584647E-7
lung cancer 4473 2.44392921677727E-5
pancreatic cancer 2300 4.18747019588063E-5
posterior fossa group A ependymoma 1511 2.24225302161797E-4
Atopic dermatitis 944 3.81988155563757E-4
glioblastoma 5572 6.23575774883418E-4
tuberculosis and treatment for 3 months 327 0.00144645917945894
primary Sjogren syndrome 789 0.00147724818579268
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.00162901613171433
ovarian cancer 8492 0.00196128895653495
pediatric high grade glioma 2712 0.00264346556793452
active Crohn's disease 918 0.0036075609306451
cutaneous lupus erythematosus 1056 0.00480886655810085
adrenocortical carcinoma 1427 0.00529399056824206
intraductal papillary-mucinous adenoma (IPMA) 2956 0.00799410286243187
cystic fibrosis and chronic rhinosinusitis 213 0.0100852716138468
ductal carcinoma in situ 1745 0.01988163940494
chronic rhinosinusitis 512 0.0207589743278408
mucosa-associated lymphoid tissue lymphoma 480 0.0207821443950875
invasive ductal carcinoma 2950 0.0212599305127841
pancreatic ductal adenocarcinoma liver metastasis 1795 0.0312120635897412
Waldenstrons macroglobulinemia 765 0.0455395019012961
Disease Target Count Z-score Confidence
Pellagra 25 4.011 2.0
Disease Target Count
Hydroxykynureninuria 1

Expression

Synonym

Accession Q16719 B2RCZ5 D3DP79 Q6I9T2 Q9BVW3
Symbols KYNUU

Gene

PANTHER Protein Class (1)

PDB

2HZP   3E9K  

  Ortholog (14)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA EggNOG Inparanoid
Horse OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Pig OMA EggNOG
Opossum OMA EggNOG Inparanoid
Chicken OMA EggNOG Inparanoid
Anole lizard OMA EggNOG Inparanoid
Xenopus OMA EggNOG
C. elegans OMA Inparanoid
S.cerevisiae OMA EggNOG Inparanoid

 GWAS Trait (1)

Gene RIF (6)

PMID Text
24667918 Microarray analysis indicates HIV-1 Tat-induced upregulation of kynureninase (KYNU) in primary human brain microvascular endothelial cells
22012986 A rare variant at the KYNU gene is associated with essential hypertension in the Han Chinese population.
20877624 Observational study of gene-disease association. (HuGE Navigator)
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
16080802 The Lys412Glu polymorphism of the KYNU gene in a hypertensive candidate chromosomal region is associated with essential hypertension in Han Chinese.
16080802 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MEPSSLELPADTVQRIAAELKCHPTDERVALHLDEEDKLRHFRECFYIPKIQDLPPVDLSLVNKDENAIY      1 - 70
FLGNSLGLQPKMVKTYLEEELDKWAKIAAYGHEVGKRPWITGDESIVGLMKDIVGANEKEIALMNALTVN     71 - 140
LHLLMLSFFKPTPKRYKILLEAKAFPSDHYAIESQLQLHGLNIEESMRMIKPREGEETLRIEDILEVIEK    141 - 210
EGDSIAVILFSGVHFYTGQHFNIPAITKAGQAKGCYVGFDLAHAVGNVELYLHDWGVDFACWCSYKYLNA    211 - 280
GAGGIAGAFIHEKHAHTIKPALVGWFGHELSTRFKMDNKLQLIPGVCGFRISNPPILLVCSLHASLEIFK    281 - 350
QATMKALRKKSVLLTGYLEYLIKHNYGKDKAATKKPVVNIITPSHVEERGCQLTITFSVPNKDVFQELEK    351 - 420
RGVVCDKRNPNGIRVAPVPLYNSFHDVYKFTNLLTSILDSAETKN                             421 - 465
//

Text Mined References (25)

PMID Year Title
25343990 2015 Genome-wide association study of selenium concentrations.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22012986 2011 A rare variant at the KYNU gene is associated with kynureninase activity and essential hypertension in the Han Chinese population.
21269460 2011 Initial characterization of the human central proteome.
20877624 2010 Genetic variants in nuclear-encoded mitochondrial genes influence AIDS progression.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17334708 2007 Xanthurenic aciduria due to a mutation in KYNU encoding kynureninase.
17300176 2007 Crystal structure of Homo sapiens kynureninase.
More...