Property Summary

Ligand Count 1
NCBI Gene PubMed Count 26
PubMed Score 33.41
PubTator Score 209.63

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (8)

Disease log2 FC p
astrocytoma -1.300 2.4e-02
atypical teratoid / rhabdoid tumor -1.500 3.2e-05
glioblastoma -1.300 2.5e-02
hereditary spastic paraplegia -1.105 1.2e-02
lung carcinoma 1.400 2.7e-18
Multiple myeloma 1.988 9.4e-05
osteosarcoma 1.193 1.0e-02
Parkinson's disease -1.300 3.1e-02

Gene RIF (7)

AA Sequence

MAGVLKKTTGLVGLAVCNTPHERLRILYTKILDVLEEIPKNAAYRKYTEQITNEKLAMVKAEPDVKKLED      1 - 70
QLQGGQLEEVILQAEHELNLARKMREWKLWEPLVEEPPADQWKWPI                             71 - 116
//

Text Mined References (31)

PMID Year Title