Property Summary

NCBI Gene PubMed Count 24
Grant Count 25
R01 Count 25
Funding $5,099,548.5
PubMed Score 32.84
PubTator Score 209.63

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (8)

Disease log2 FC p
Multiple myeloma 1.988 0.000
osteosarcoma 1.193 0.010
astrocytoma -1.300 0.024
glioblastoma -1.300 0.025
atypical teratoid / rhabdoid tumor -1.500 0.000
hereditary spastic paraplegia -1.105 0.012
Parkinson's disease -1.300 0.031
lung carcinoma 1.400 0.000

Gene RIF (7)

PMID Text
24717771 NDUFA3, NDUFA5 and NDUFA12 supernumerary subunits are necessary for complex I activity and biogenesis.
20877624 Observational study of gene-disease association. (HuGE Navigator)
20825370 SNPs rs12666974 and rs3779262 significantly associated with autism
20825370 Observational study of gene-disease association. (HuGE Navigator)
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19343046 Observational study of gene-disease association. (HuGE Navigator)
19064571 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MAGVLKKTTGLVGLAVCNTPHERLRILYTKILDVLEEIPKNAAYRKYTEQITNEKLAMVKAEPDVKKLED      1 - 70
QLQGGQLEEVILQAEHELNLARKMREWKLWEPLVEEPPADQWKWPI                             71 - 116
//

Text Mined References (29)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
24717771 2014 Supernumerary subunits NDUFA3, NDUFA5 and NDUFA12 are required for the formation of the extramembrane arm of human mitochondrial complex I.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23088660 2013 Downregulation of the expression of mitochondrial electron transport complex genes in autism brains.
23051583 2012 Spatial distribution of cellular function: the partitioning of proteins between mitochondria and the nucleus in MCF7 breast cancer cells.
21775499 2011 Decreased expression of genes involved in oxidative phosphorylation in human pancreatic islets from patients with type 2 diabetes.
21269460 2011 Initial characterization of the human central proteome.
20877624 2010 Genetic variants in nuclear-encoded mitochondrial genes influence AIDS progression.
20825370 2011 The NADH-ubiquinone oxidoreductase 1 alpha subcomplex 5 (NDUFA5) gene variants are associated with autism.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
More...