Property Summary

NCBI Gene PubMed Count 26
PubMed Score 17.10
PubTator Score 301.93

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (4)

Disease Target Count
Schizophrenia 503
Disease Target Count P-value
lung carcinoma 2844 1.67738936371722E-26
ovarian cancer 8492 7.32087087233843E-10
juvenile dermatomyositis 1189 3.61041898743942E-8
cystic fibrosis 1670 3.51511653660875E-5
osteosarcoma 7933 3.46799680537777E-4
pilocytic astrocytoma 3086 6.93220209079535E-4
acute quadriplegic myopathy 1157 9.20315253317951E-4
primary Sjogren syndrome 789 9.3245185623159E-4
group 4 medulloblastoma 1875 0.00245306862992412
Down syndrome 548 0.00385417337289988
pancreatic ductal adenocarcinoma liver metastasis 1795 0.00585220304250129
Multiple myeloma 1328 0.00664403883250253
pediatric high grade glioma 2712 0.00678295099895489
progressive supranuclear palsy 674 0.00814065506999065
medulloblastoma, large-cell 6234 0.00999439155321599
Pick disease 1893 0.0121938599795857
glioblastoma 5572 0.0142016908441563
Disease Target Count Z-score Confidence
Carcinoma 2147 0.0 1.0
Disease Target Count Z-score Confidence
Congenital dyserythropoietic anemia 17 4.265 2.1
alpha-mannosidosis 9 3.798 1.9

Expression

  Differential Expression (17)

Disease log2 FC p
Multiple myeloma 1.568 0.007
osteosarcoma 2.127 0.000
cystic fibrosis 1.026 0.000
glioblastoma 1.300 0.014
medulloblastoma, large-cell -1.400 0.010
juvenile dermatomyositis 1.001 0.000
acute quadriplegic myopathy 1.032 0.001
pancreatic ductal adenocarcinoma liver m... -2.357 0.006
pediatric high grade glioma 1.200 0.007
group 4 medulloblastoma -1.600 0.002
pilocytic astrocytoma 1.300 0.001
primary Sjogren syndrome 1.100 0.001
lung carcinoma 1.100 0.000
Pick disease -1.100 0.012
progressive supranuclear palsy -1.900 0.008
ovarian cancer -2.000 0.000
Down syndrome 1.200 0.004

Synonym

Accession Q16706 Q16767
Symbols MANA2
MANII
GOLIM7
AMan II

Gene

PANTHER Protein Class (2)

  Ortholog (10)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG
Cow OMA EggNOG Inparanoid
Opossum OMA Inparanoid
Platypus OMA Inparanoid
Chicken OMA EggNOG Inparanoid
Anole lizard OMA EggNOG Inparanoid
Xenopus OMA EggNOG

Gene RIF (27)

PMID Text
20512086 KCNQ and AP3S1, but not MAN2A1 or ALDH7A1 have a role in risk of type 2 diabetes in the Chinese Northern Han population
20512086 Observational study and meta-analysis of gene-disease association. (HuGE Navigator)
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20189245 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
18330979 Oligosaccharide side-chains of HIV-1 gp160 are processed by glycosidase I and II, mannosidase I and II, acetylglucosaminyl transferase I and II, and fucosyl, galactosyl and sialyl transferases in both the endoplasmic reticulum and golgi apparatus
18314154 Oligosaccharide side-chains of HIV-1 gp160 are processed by glycosidase I and II, mannosidase I and II, acetylglucosaminyl transferase I and II, and fucosyl, galactosyl and sialyl transferases in both the endoplasmic reticulum and golgi apparatus
18215327 Oligosaccharide side-chains of HIV-1 gp160 are processed by glycosidase I and II, mannosidase I and II, acetylglucosaminyl transferase I and II, and fucosyl, galactosyl and sialyl transferases in both the endoplasmic reticulum and golgi apparatus
18174230 Observational study of gene-disease association. (HuGE Navigator)
17466984 The disruption of Golgi alpha-mannosidase II activity by swainsonine in human embryonic kidney cells is capable of inducing a novel class of hybrid-type glycosylation containing a partially processed mannose moiety.
12560567 Oligosaccharide side-chains of HIV-1 gp160 are processed by glycosidase I and II, mannosidase I and II, acetylglucosaminyl transferase I and II, and fucosyl, galactosyl and sialyl transferases in both the endoplasmic reticulum and golgi apparatus
More...

AA Sequence

MKLSRQFTVFGSAIFCVVIFSLYLMLDRGHLDYPRNPRREGSFPQGQLSMLQEKIDHLERLLAENNEIIS      1 - 70
NIRDSVINLSESVEDGPKSSQSNFSQGAGSHLLPSQLSLSVDTADCLFASQSGSHNSDVQMLDVYSLISF     71 - 140
DNPDGGVWKQGFDITYESNEWDTEPLQVFVVPHSHNDPGWLKTFNDYFRDKTQYIFNNMVLKLKEDSRRK    141 - 210
FIWSEISYLSKWWDIIDIQKKDAVKSLIENGQLEIVTGGWVMPDEATPHYFALIDQLIEGHQWLENNIGV    211 - 280
KPRSGWAIDPFGHSPTMAYLLNRAGLSHMLIQRVHYAVKKHFALHKTLEFFWRQNWDLGSVTDILCHMMP    281 - 350
FYSYDIPHTCGPDPKICCQFDFKRLPGGRFGCPWGVPPETIHPGNVQSRARMLLDQYRKKSKLFRTKVLL    351 - 420
APLGDDFRYCEYTEWDLQFKNYQQLFDYMNSQSKFKVKIQFGTLSDFFDALDKADETQRDKGQSMFPVLS    421 - 490
GDFFTYADRDDHYWSGYFTSRPFYKRMDRIMESHLRAAEILYYFALRQAHKYKINKFLSSSLYTALTEAR    491 - 560
RNLGLFQHHDAITGTAKDWVVVDYGTRLFHSLMVLEKIIGNSAFLLILKDKLTYDSYSPDTFLEMDLKQK    561 - 630
SQDSLPQKNIIRLSAEPRYLVVYNPLEQDRISLVSVYVSSPTVQVFSASGKPVEVQVSAVWDTANTISET    631 - 700
AYEISFRAHIPPLGLKVYKILESASSNSHLADYVLYKNKVEDSGIFTIKNMINTEEGITLENSFVLLRFD    701 - 770
QTGLMKQMMTKEDGKHHEVNVQFSWYGTTIKRDKSGAYLFLPDGNAKPYVYTTPPFVRVTHGRIYSEVTC    771 - 840
FFDHVTHRVRLYHIQGIEGQSVEVSNIVDIRKVYNREIAMKISSDIKSQNRFYTDLNGYQIQPRMTLSKL    841 - 910
PLQANVYPMTTMAYIQDAKHRLTLLSAQSLGVSSLNSGQIEVIMDRRLMQDDNRGLEQGIQDNKITANLF    911 - 980
RILLEKRSAVNTEEEKKSVSYPSLLSHITSSLMNHPVIPMANKFSSPTLELQGEFSPLQSSLPCDIHLVN    981 - 1050
LRTIQSKVGNGHSNEAALILHRKGFDCRFSSKGTGLFCSTTQGKILVQKLLNKFIVESLTPSSLSLMHSP   1051 - 1120
PGTQNISEINLSPMEISTFRIQLR                                                 1121 - 1144
//

Text Mined References (30)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25787250 2015 Neomorphic effects of recurrent somatic mutations in Yin Yang 1 in insulin-producing adenomas.
25056061 2014 Biological insights from 108 schizophrenia-associated genetic loci.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23535033 2014 Genome-wide association study of the rate of cognitive decline in Alzheimer's disease.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
21269460 2011 Initial characterization of the human central proteome.
20512086 2010 Variants in KCNQ1, AP3S1, MAN2A1, and ALDH7A1 and the risk of type 2 diabetes in the Chinese Northern Han population: a case-control study and meta-analysis.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
More...