Property Summary

NCBI Gene PubMed Count 29
PubMed Score 18.72
PubTator Score 301.93

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (17)

Disease log2 FC p
acute quadriplegic myopathy 1.032 9.2e-04
Astrocytoma, Pilocytic 1.300 8.6e-04
cystic fibrosis 1.026 3.5e-05
Down syndrome 1.200 3.9e-03
glioblastoma 1.300 1.4e-02
group 4 medulloblastoma -1.600 2.5e-03
juvenile dermatomyositis 1.001 3.6e-08
lung carcinoma 1.100 1.7e-26
medulloblastoma, large-cell -1.400 1.0e-02
Multiple myeloma 1.568 6.6e-03
osteosarcoma 2.127 3.5e-04
ovarian cancer -2.000 7.3e-10
pancreatic ductal adenocarcinoma liver m... -1.706 9.8e-03
pediatric high grade glioma 1.200 6.8e-03
Pick disease -1.100 1.2e-02
primary Sjogren syndrome 1.100 9.3e-04
progressive supranuclear palsy -1.900 8.1e-03

Gene RIF (29)

AA Sequence

MKLSRQFTVFGSAIFCVVIFSLYLMLDRGHLDYPRNPRREGSFPQGQLSMLQEKIDHLERLLAENNEIIS      1 - 70
NIRDSVINLSESVEDGPKSSQSNFSQGAGSHLLPSQLSLSVDTADCLFASQSGSHNSDVQMLDVYSLISF     71 - 140
DNPDGGVWKQGFDITYESNEWDTEPLQVFVVPHSHNDPGWLKTFNDYFRDKTQYIFNNMVLKLKEDSRRK    141 - 210
FIWSEISYLSKWWDIIDIQKKDAVKSLIENGQLEIVTGGWVMPDEATPHYFALIDQLIEGHQWLENNIGV    211 - 280
KPRSGWAIDPFGHSPTMAYLLNRAGLSHMLIQRVHYAVKKHFALHKTLEFFWRQNWDLGSVTDILCHMMP    281 - 350
FYSYDIPHTCGPDPKICCQFDFKRLPGGRFGCPWGVPPETIHPGNVQSRARMLLDQYRKKSKLFRTKVLL    351 - 420
APLGDDFRYCEYTEWDLQFKNYQQLFDYMNSQSKFKVKIQFGTLSDFFDALDKADETQRDKGQSMFPVLS    421 - 490
GDFFTYADRDDHYWSGYFTSRPFYKRMDRIMESHLRAAEILYYFALRQAHKYKINKFLSSSLYTALTEAR    491 - 560
RNLGLFQHHDAITGTAKDWVVVDYGTRLFHSLMVLEKIIGNSAFLLILKDKLTYDSYSPDTFLEMDLKQK    561 - 630
SQDSLPQKNIIRLSAEPRYLVVYNPLEQDRISLVSVYVSSPTVQVFSASGKPVEVQVSAVWDTANTISET    631 - 700
AYEISFRAHIPPLGLKVYKILESASSNSHLADYVLYKNKVEDSGIFTIKNMINTEEGITLENSFVLLRFD    701 - 770
QTGLMKQMMTKEDGKHHEVNVQFSWYGTTIKRDKSGAYLFLPDGNAKPYVYTTPPFVRVTHGRIYSEVTC    771 - 840
FFDHVTHRVRLYHIQGIEGQSVEVSNIVDIRKVYNREIAMKISSDIKSQNRFYTDLNGYQIQPRMTLSKL    841 - 910
PLQANVYPMTTMAYIQDAKHRLTLLSAQSLGVSSLNSGQIEVIMDRRLMQDDNRGLEQGIQDNKITANLF    911 - 980
RILLEKRSAVNTEEEKKSVSYPSLLSHITSSLMNHPVIPMANKFSSPTLELQGEFSPLQSSLPCDIHLVN    981 - 1050
LRTIQSKVGNGHSNEAALILHRKGFDCRFSSKGTGLFCSTTQGKILVQKLLNKFIVESLTPSSLSLMHSP   1051 - 1120
PGTQNISEINLSPMEISTFRIQLR                                                 1121 - 1144
//

Text Mined References (33)

PMID Year Title