Property Summary

NCBI Gene PubMed Count 30
PubMed Score 15887.91
PubTator Score 507.95

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (8)

Disease log2 FC p
astrocytoma 1.100 3.9e-03
malignant mesothelioma -7.600 9.5e-10
Multiple myeloma 1.526 1.2e-03
ovarian cancer -1.900 2.6e-06
pancreatic ductal adenocarcinoma liver m... -1.106 2.1e-02
posterior fossa group B ependymoma 1.100 1.4e-10
subependymal giant cell astrocytoma 1.657 3.2e-02
tuberculosis 1.400 3.0e-06

Gene RIF (11)

AA Sequence

MKLPARVFFTLGSRLPCGLAPRRFFSYGTKILYQNTEALQSKFFSPLQKAMLPPNSFQGKVAFITGGGTG      1 - 70
LGKGMTTLLSSLGAQCVIASRKMDVLKATAEQISSQTGNKVHAIQCDVRDPDMVQNTVSELIKVAGHPNI     71 - 140
VINNAAGNFISPTERLSPNAWKTITDIVLNGTAFVTLEIGKQLIKAQKGAAFLSITTIYAETGSGFVVPS    141 - 210
ASAKAGVEAMSKSLAAEWGKYGMRFNVIQPGPIKTKGAFSRLDPTGTFEKEMIGRIPCGRLGTVEELANL    211 - 280
AAFLCSDYASWINGAVIKFDGGEEVLISGEFNDLRKVTKEQWDTIEELIRKTKGS                   281 - 335
//

Text Mined References (36)

PMID Year Title