Property Summary

NCBI Gene PubMed Count 50
Grant Count 37
R01 Count 27
Funding $5,361,934.15
PubMed Score 132.88
PubTator Score 96.39

Knowledge Summary

Patent

No data available

Gene RIF (46)

PMID Text
25710941 CYP2A13 levels in human lungs can be suppressed by disease-associated inflammation in tissue donors.
25667220 an etiologically relevant interaction between CYP2A13 and ABCB1 associated with lung cancer was analysed
24907355 The transgenic CYP2A13 is active.
24114584 CYP2A13 played a critical role in AFB1-induced neoplastic transformation.
23917075 CYP2A13 is efficient in 4-(methylnitrosamino)-1-(3-pyridyl)-1-butanone bioactivation in vivo and it can mediate 4-(methylnitrosamino)-1-(3-pyridyl)-1-butanone-induced lung tumorigenesis.
23907605 Data suggest important role of CYP2A13 in AFG1- (aflatoxin G1)-induced cytotoxicity, DNA damage, and activation of signal pathways in bronchial epithelium; data suggest similarities in CYP2A13-catalyzed bioactivation of AFG1 and AFB1 (aflatoxin B1).
23752126 Findings suggest the potential involvement of pulmonary CYP2A13 in the early occurrence of NSCLC as well as in the development of EGFR gene mutations.
23602888 Findings suggest that CYP2A13 plays an important role in low-concentration AFB1-induced DNA damage, possibly linking environmental airborne AFB1 to genetic injury in human respiratory system.
23583631 CYP2A13 plays an important role in low-concentration AFB1-induced DNA damage, possibly linking environmental airborne AFB1 to genetic injury in the human respiratory system.
23463547 an efficient approach for expressing functionally characterized, highly active and homogeneous CYP2A13 proteins.
More...

AA Sequence

MLASGLLLVTLLACLTVMVLMSVWRQRKSRGKLPPGPTPLPFIGNYLQLNTEQMYNSLMKISERYGPVFT      1 - 70
IHLGPRRVVVLCGHDAVKEALVDQAEEFSGRGEQATFDWLFKGYGVAFSNGERAKQLRRFSIATLRGFGV     71 - 140
GKRGIEERIQEEAGFLIDALRGTHGANIDPTFFLSRTVSNVISSIVFGDRFDYEDKEFLSLLRMMLGSFQ    141 - 210
FTATSTGQLYEMFSSVMKHLPGPQQQAFKELQGLEDFIAKKVEHNQRTLDPNSPRDFIDSFLIRMQEEEK    211 - 280
NPNTEFYLKNLVMTTLNLFFAGTETVSTTLRYGFLLLMKHPEVEAKVHEEIDRVIGKNRQPKFEDRAKMP    281 - 350
YTEAVIHEIQRFGDMLPMGLAHRVNKDTKFRDFFLPKGTEVFPMLGSVLRDPRFFSNPRDFNPQHFLDKK    351 - 420
GQFKKSDAFVPFSIGKRYCFGEGLARMELFLFFTTIMQNFRFKSPQSPKDIDVSPKHVGFATIPRNYTMS    421 - 490
FLPR                                                                      491 - 494
//

Text Mined References (52)

PMID Year Title
25710941 2015 Suppression of pulmonary CYP2A13 expression by carcinogen-induced lung tumorigenesis in a CYP2A13-humanized mouse model.
25667220 2015 Pulmonary expression of CYP2A13 and ABCB1 is regulated by FOXA2, and their genetic interaction is associated with lung cancer.
24907355 2014 Generation and characterization of a novel CYP2A13--transgenic mouse model.
24114584 2014 Cytochrome P450 2A13 mediates the neoplastic transformation of human bronchial epithelial cells at a low concentration of aflatoxin B1.
23917075 2014 Role of CYP2A13 in the bioactivation and lung tumorigenicity of the tobacco-specific lung procarcinogen 4-(methylnitrosamino)-1-(3-pyridyl)-1-butanone: in vivo studies using a CYP2A13-humanized mouse model.
23907605 2013 Cytochrome P450 2A13 is an efficient enzyme in metabolic activation of aflatoxin G1 in human bronchial epithelial cells.
23752126 2013 Pulmonary CYP2A13 levels are associated with early occurrence of lung cancer-Its implication in mutagenesis of non-small cell lung carcinoma.
23602888 2013 Cytochrome P450 2A13 enhances the sensitivity of human bronchial epithelial cells to aflatoxin B1-induced DNA damage.
23583631 2013 Hypoxia inducible factor-1 (HIF-1)-flavin containing monooxygenase-2 (FMO-2) signaling acts in silver nanoparticles and silver ion toxicity in the nematode, Caenorhabditis elegans.
23463547 2013 Optimization of heme precursors for the expression of human cytochrome P450 2A13 and its co-expression with oxidoreductase in baculovirus/sf9 system.
More...