Property Summary

NCBI Gene PubMed Count 129
Grant Count 38
R01 Count 12
Funding $4,261,914.08
PubMed Score 9.93
PubTator Score 12.92

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (3)

Expression

  Differential Expression (1)

Disease log2 FC p
breast carcinoma 1.800 0.005

Gene RIF (71)

PMID Text
26719341 Data suggest chromatin exhibits histone 3 methylation markers (H3K4me3, H3K27me3) in fetal brain, heart, and liver, probably to keep progenitor cells in these organs ready for immediate differentiation. (study of 12-week aborted embryo tissues, China)
26669263 EP400 deposits H3.3 into chromatin alongside H2AZ and contributes to gene regulation after Pol II pre-initiation complex assembly.
26575220 Regulators of the histone H3-trimethyl lysine-4 (H3K4me3) mark are significantly associated with the genetic risk architecture of common neurodevelopmental disease.
26482474 Screening for H3.3 G34 mutation should therefore be recommended as a routine diagnostic marker for supratentorial central nervous system tumors
26291278 Our data highlights the complex interplay between Nrf2 and H3S10 phosphorylation in arsenite-activated HO-1 transcription.
25712104 Data indicate the role for histone demethylase KDM5C/JARID1C in a specific phase of DNA replication in mammalian cells, through its demethylase activity on histone H3K4me3.
25696994 Posttranslational modifications of H3 histone (methylation) does not correlate with the sox2 expression in malignant gliomas.
25690891 Findings suggest a role of checkpoint kinase 1 (CHK1) as an histone H3.3 serine 31 kinase.
25560918 TIP60 interacted with H3K4me3 in response to TNF-alpha signaling.
25519907 histone H3 lysine 9 acetylation has a dual role in human embryonic stem cell pluripotency and neural differentiation
More...

AA Sequence

MARTKQTARKSTGGKAPRKQLATKVARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQR      1 - 70
LMREIAQDFKTDLRFQSSAVMALQEACESYLVGLFEDTNLCVIHAKRVTIMPKDIQLARRIRGERA         71 - 136
//

Text Mined References (133)

PMID Year Title
26719341 2016 Epigenomic Landscape of Human Fetal Brain, Heart, and Liver.
26669263 2016 EP400 Deposits H3.3 into Promoters and Enhancers during Gene Activation.
26575220 2015 Deciphering H3K4me3 broad domains associated with gene-regulatory networks and conserved epigenomic landscapes in the human brain.
26482474 2016 Histologically distinct neuroepithelial tumors with histone 3 G34 mutation are molecularly similar and comprise a single nosologic entity.
26291278 2015 Coordinated regulation of Nrf2 and histone H3 serine 10 phosphorylation in arsenite-activated transcription of the human heme oxygenase-1 gene.
25712104 2015 H3K4me3 demethylation by the histone demethylase KDM5C/JARID1C promotes DNA replication origin firing.
25696994 2014 [Aberrant expression of sox2 gene in malignant gliomas].
25690891 2015 CHK1-driven histone H3.3 serine 31 phosphorylation is important for chromatin maintenance and cell survival in human ALT cancer cells.
25615412 2015 Human tNASP promotes in vitro nucleosome assembly with histone H3.3.
25560918 2015 The chromodomain-containing histone acetyltransferase TIP60 acts as a code reader, recognizing the epigenetic codes for initiating transcription.
More...