Property Summary

NCBI Gene PubMed Count 133
PubMed Score 10.93
PubTator Score 12.92

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count Z-score Confidence
Intellectual disability 1016 0.0 0.0
Pneumoconiosis 15 0.0 0.0
Disease Target Count P-value
breast carcinoma 1638 4.8e-03
Disease Target Count Z-score Confidence
Male infertility 206 3.104 1.6

Expression

  Differential Expression (1)

Disease log2 FC p
breast carcinoma 1.800 4.8e-03

Gene RIF (75)

AA Sequence

MARTKQTARKSTGGKAPRKQLATKVARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQR      1 - 70
LMREIAQDFKTDLRFQSSAVMALQEACESYLVGLFEDTNLCVIHAKRVTIMPKDIQLARRIRGERA         71 - 136
//

Text Mined References (137)

PMID Year Title