Property Summary

NCBI Gene PubMed Count 26
Grant Count 78
R01 Count 49
Funding $7,836,239.83
PubMed Score 293.28
PubTator Score 34.64

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession Q16690 Q12997 Q5T603
Symbols DUSP
HVH3

Gene

PDB

2G6Z  

Gene RIF (18)

PMID Text
25519881 The DUSP5 S147P protein is hypoactive compared to the DUSP5 wild-type protein.
24651368 Data indicate that cells from Burkitt's lymphoma, leukemia, neuroblastoma and Ewing sarcoma showed a higher dual-specificity phosphatase 5 pseudogene 1 (DUSP5P1)/dual specificity phosphatase 5 (DUSP5 ratio than normal cells.
24308939 DUSP1, DUSP4, and DUSP5 differentially modulate endothelial MAPK signaling pathways downstream of Tie-2 receptors.
23402999 DUSP5 methylation may serve as a prognostic marker for gastric cancer (GC), but this requires validation in a larger set of GC samples.
22812510 Studies indicate that dual-specificity MAP kinase phosphatases (MKPs) DUSP6/MKP-3 and DUSP5 are localized in the cytoplasm and nuclear compartments.
20806045 DUSP5 and DUSP6 selectively control ERK pathway activity and proliferation.
20628624 Meta-analysis of gene-disease association. (HuGE Navigator)
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20554528 the differential up-regulation of MKP3 by Ets2 and of DUSP5 by c-Jun may converge in similar functional roles for these MAP kinase phosphatases in the growth arrest versus proliferation decisions of breast cancer cells
19913121 Observational study of gene-disease association. (HuGE Navigator)
More...

AA Sequence

MKVTSLDGRQLRKMLRKEAAARCVVLDCRPYLAFAASNVRGSLNVNLNSVVLRRARGGAVSARYVLPDEA      1 - 70
ARARLLQEGGGGVAAVVVLDQGSRHWQKLREESAARVVLTSLLACLPAGPRVYFLKGGYETFYSEYPECC     71 - 140
VDVKPISQEKIESERALISQCGKPVVNVSYRPAYDQGGPVEILPFLYLGSAYHASKCEFLANLHITALLN    141 - 210
VSRRTSEACATHLHYKWIPVEDSHTADISSHFQEAIDFIDCVREKGGKVLVHCEAGISRSPTICMAYLMK    211 - 280
TKQFRLKEAFDYIKQRRSMVSPNFGFMGQLLQYESEILPSTPNPQPPSCQGEAAGSSLIGHLQTLSPDMQ    281 - 350
GAYCTFPASVLAPVPTHSTVSELSRSPVATATSC                                        351 - 384
//

Text Mined References (27)

PMID Year Title
25519881 2014 Protein expression, characterization and activity comparisons of wild type and mutant DUSP5 proteins.
24651368 2014 Expression of dual-specificity phosphatase 5 pseudogene 1 (DUSP5P1) in tumor cells.
24531476 2014 The family-wide structure and function of human dual-specificity protein phosphatases.
24308939 2013 Regulation of angiopoietin-1/Tie-2 receptor signaling in endothelial cells by dual-specificity phosphatases 1, 4, and 5.
23850713 2014 Genome-wide association study of Crohn's disease in Koreans revealed three new susceptibility loci and common attributes of genetic susceptibility across ethnic populations.
23402999 2013 Down-regulation of dual-specificity phosphatase 5 in gastric cancer by promoter CpG island hypermethylation and its potential role in carcinogenesis.
22812510 2013 Dual-specificity MAP kinase phosphatases (MKPs): shaping the outcome of MAP kinase signalling.
20806045 2010 DUSP5 and DUSP6 modulate corneal epithelial cell proliferation.
20628624 2010 Evaluation of candidate stromal epithelial cross-talk genes identifies association between risk of serous ovarian cancer and TERT, a cancer susceptibility "hot-spot".
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
More...