Property Summary

NCBI Gene PubMed Count 29
PubMed Score 308.98
PubTator Score 34.64

Knowledge Summary

Patent

No data available

Expression

Gene RIF (21)

AA Sequence

MKVTSLDGRQLRKMLRKEAAARCVVLDCRPYLAFAASNVRGSLNVNLNSVVLRRARGGAVSARYVLPDEA      1 - 70
ARARLLQEGGGGVAAVVVLDQGSRHWQKLREESAARVVLTSLLACLPAGPRVYFLKGGYETFYSEYPECC     71 - 140
VDVKPISQEKIESERALISQCGKPVVNVSYRPAYDQGGPVEILPFLYLGSAYHASKCEFLANLHITALLN    141 - 210
VSRRTSEACATHLHYKWIPVEDSHTADISSHFQEAIDFIDCVREKGGKVLVHCEAGISRSPTICMAYLMK    211 - 280
TKQFRLKEAFDYIKQRRSMVSPNFGFMGQLLQYESEILPSTPNPQPPSCQGEAAGSSLIGHLQTLSPDMQ    281 - 350
GAYCTFPASVLAPVPTHSTVSELSRSPVATATSC                                        351 - 384
//

Text Mined References (30)

PMID Year Title