Property Summary

NCBI Gene PubMed Count 474
PubMed Score 863.42
PubTator Score 1160.42

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (6)

Disease Target Count P-value
lung carcinoma 2844 1.37597846880832E-10
malignant mesothelioma 3163 1.31442553943879E-7
cystic fibrosis 1670 3.51551113853196E-7
juvenile dermatomyositis 1189 4.94044813842957E-7
psoriasis 6685 1.42981611310705E-6
tuberculosis 1563 7.65562972922129E-6
astrocytoma 1493 1.08084577565051E-5
lung cancer 4473 2.92379858103304E-5
pituitary cancer 1972 8.27870449258772E-5
acute quadriplegic myopathy 1157 8.72301424244924E-5
fascioscapulohumeral muscular dystrophy 100 1.89504660143405E-4
group 4 medulloblastoma 1875 3.53721839512044E-4
primary pancreatic ductal adenocarcinoma 1271 8.20236031065277E-4
primary Sjogren syndrome 789 8.73708130662026E-4
COPD 116 0.00150265948069329
pancreatic carcinoma 567 0.00153545570488642
adrenocortical carcinoma 1427 0.00269950883853661
medulloblastoma, large-cell 6234 0.00329224765080093
intraductal papillary-mucinous adenoma (IPMA) 2956 0.00337623723349632
intraductal papillary-mucinous carcinoma (IPMC) 2988 0.00366782805161602
Pick disease 1893 0.00433917541221993
pancreatic cancer 2300 0.00514655750296975
limb girdle muscular dystrophy 2B 74 0.00754981141165968
ovarian cancer 8492 0.008468340238603
lung adenocarcinoma 2714 0.00911323630033598
hepatocellular carcinoma 550 0.0107362537399739
interstitial cystitis 2299 0.012168810904912
non diabetic and post-ischemic heart failure 200 0.0124671227108124
mucosa-associated lymphoid tissue lymphoma 480 0.0142526751163212
osteosarcoma 7933 0.0205074600388199
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.0245012100626624
ulcerative colitis 2087 0.0246423142115799
Rheumatoid Arthritis 1171 0.0252538445251965
diabetes mellitus 1663 0.0259236731731981
Gaucher disease type 1 171 0.0345049347116159
oligodendroglioma 2849 0.0359342074073853
subependymal giant cell astrocytoma 2287 0.0378178095629398
Breast cancer 3099 0.0386233333919462
posterior fossa group A ependymoma 1511 0.0415681981534584
pulmonary arterial hypertension 36 0.0447930564683464
Disease Target Count Z-score Confidence
Glaucoma 135 6.291 3.1
Corneal disease 32 0.0 4.0
Disease Target Count
Peters anomaly 4

Expression

  Differential Expression (40)

Synonym

Accession Q16678 Q5TZW8 Q93089 Q9H316
Symbols CP1B
GLC3A
CYPIB1
P4501B1

Gene

PANTHER Protein Class (2)

PDB

3PM0  

  Ortholog (6)

Species Source
Mouse OMA Inparanoid
Rat OMA Inparanoid
Dog OMA Inparanoid
Cow OMA Inparanoid
Xenopus OMA Inparanoid
Zebrafish OMA Inparanoid

Gene RIF (536)

PMID Text
26981862 data suggests that CYP1B1 promotes cell proliferation and metastasis by inducing EMT and Wnt/beta-catenin signaling via Sp1 induction
26681220 the single nucleotide polymorphisms rs180040 and rs1056827 of CYP1B1 showed an association with risk of primary open-angle glaucoma (Meta-Analysis)
26663047 Data show that the AS-PCR/RFLP assay has successfully constructed the haplotypes of the cytochrome P-450 CYP1B1 (CYP1B1) gene.
26647441 African-American women, the CYP1B1 SNP rs162561 was associated with right ventricular ejection fraction.
26626260 Results show that CYP1B1 may promote renal cell carcinoma development by inducing CDC20 expression and inhibiting apoptosis through the down-regulation of DAPK1.
26507668 CYP1B1 genetic polymorphisms may influence outcome of taxane therapy in Roma and Hungarian populations.
26466350 drugs acting as D2-dopamine receptor antagonists can modify several hormone systems that regulate the expression of CYP1A1, CYP1A2 and CYP1B1, and may affect the toxicity and carcinogenicity outcome of numerous toxicants and pre-carcinogenic substances
26225675 Leu432Val Polymorphism of CYP1B1 is Not Associated with Squamous Cell Carcinoma of Esophagus.
26198313 Data from pharmacogenomic studies suggest that SNPs in CYP1B1 or ABCB1 (ATP binding cassette subfamily B member 1) are responsible for taxane toxicity when used as chemotherapeutic agent in some women with breast cancer. [REVIEW]
26164761 This is the first ever report of a CYP1B1 variant segregating in a consanguineous family with co-existence of juvenile-onset open angle glaucoma and primary congenital glaucoma in two subsequent generations.
More...

AA Sequence

MGTSLSPNDPWPLNPLSIQQTTLLLLLSVLATVHVGQRLLRQRRRQLRSAPPGPFAWPLIGNAAAVGQAA      1 - 70
HLSFARLARRYGDVFQIRLGSCPIVVLNGERAIHQALVQQGSAFADRPAFASFRVVSGGRSMAFGHYSEH     71 - 140
WKVQRRAAHSMMRNFFTRQPRSRQVLEGHVLSEARELVALLVRGSADGAFLDPRPLTVVAVANVMSAVCF    141 - 210
GCRYSHDDPEFRELLSHNEEFGRTVGAGSLVDVMPWLQYFPNPVRTVFREFEQLNRNFSNFILDKFLRHC    211 - 280
ESLRPGAAPRDMMDAFILSAEKKAAGDSHGGGARLDLENVPATITDIFGASQDTLSTALQWLLLLFTRYP    281 - 350
DVQTRVQAELDQVVGRDRLPCMGDQPNLPYVLAFLYEAMRFSSFVPVTIPHATTANTSVLGYHIPKDTVV    351 - 420
FVNQWSVNHDPLKWPNPENFDPARFLDKDGLINKDLTSRVMIFSVGKRRCIGEELSKMQLFLFISILAHQ    421 - 490
CDFRANPNEPAKMNFSYGLTIKPKSFKVNVTLRESMELLDSAVQNLQAKETCQ                     491 - 543
//

Text Mined References (483)

PMID Year Title
26981862 2016 CYP1B1 Enhances Cell Proliferation and Metastasis through Induction of EMT and Activation of Wnt/?-Catenin Signaling via Sp1 Upregulation.
26681220 2015 Association of single nucleotide polymorphisms in the CYP1B1 gene with the risk of primary open-angle glaucoma: a meta-analysis.
26663047 2015 [Construction of CYP1B1 gene haplotypes predisposing to primary congenital glaucoma through allele-specific PCR/restriction fragment length polymorphism analysis].
26647441 2016 Oestradiol metabolism and androgen receptor genotypes are associated with right ventricular function.
26626260 2015 CYP1B1 promotes tumorigenesis via altered expression of CDC20 and DAPK1 genes in renal cell carcinoma.
26507668 2015 Interethnic differences of cytochrome P450 gene polymorphisms may influence outcome of taxane therapy in Roma and Hungarian populations.
26466350 2015 Dopamine D2-Receptor Antagonists Down-Regulate CYP1A1/2 and CYP1B1 in the Rat Liver.
26225675 2015 Leu432Val Polymorphism of CYP1B1 is Not Associated with Squamous Cell Carcinoma of Esophagus--a Case-Control Study from Kashmir, India.
26198313 2015 Are pharmacogenomic biomarkers an effective tool to predict taxane toxicity and outcome in breast cancer patients? Literature review.
26164761 2015 Homozygous p.G61E mutation in a consanguineous Pakistani family with co-existence of juvenile-onset open angle glaucoma and primary congenital glaucoma.
More...