Property Summary

Ligand Count 75
NCBI Gene PubMed Count 502
PubMed Score 904.38
PubTator Score 1160.42

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (7)

Disease Target Count P-value
lung carcinoma 2843 1.4e-10
lung adenocarcinoma 2716 1.9e-08
malignant mesothelioma 3232 1.3e-07
juvenile dermatomyositis 1187 3.3e-07
astrocytoma 1146 1.1e-05
tuberculosis 2010 2.3e-05
lung cancer 4740 2.9e-05
cystic fibrosis 1696 3.4e-05
fascioscapulohumeral muscular dystrophy 100 1.9e-04
primary Sjogren syndrome 735 4.8e-04
psoriasis 6694 7.4e-04
acute quadriplegic myopathy 1158 1.5e-03
pancreatic cancer 2398 1.5e-03
pancreatic carcinoma 562 1.5e-03
pituitary cancer 1972 1.8e-03
medulloblastoma, large-cell 6241 3.5e-03
group 4 medulloblastoma 1855 4.1e-03
Pick disease 1894 4.3e-03
primary pancreatic ductal adenocarcinoma 1109 4.6e-03
intraductal papillary-mucinous adenoma (IPMA) 2955 6.7e-03
COPD 118 7.0e-03
limb girdle muscular dystrophy 2B 40 7.5e-03
intraductal papillary-mucinous carcinoma (IPMC) 2989 7.6e-03
ovarian cancer 8520 8.5e-03
hepatocellular carcinoma 547 1.1e-02
interstitial cystitis 2312 1.2e-02
non diabetic and post-ischemic heart failure 200 1.2e-02
adrenocortical carcinoma 1428 1.3e-02
mucosa-associated lymphoid tissue lymphoma 484 1.4e-02
osteosarcoma 7950 2.1e-02
ulcerative colitis 1819 2.5e-02
Rheumatoid arthritis 1191 2.5e-02
diabetes mellitus 1728 2.6e-02
head and neck cancer and chronic obstructive pulmonary disease 239 2.8e-02
ependymoma 4679 3.0e-02
Gaucher disease type 1 180 3.5e-02
intraductal papillary-mucinous neoplasm (IPMN) 3291 3.8e-02
subependymal giant cell astrocytoma 2287 3.9e-02
Breast cancer 3578 3.9e-02
pulmonary arterial hypertension 75 4.5e-02
oligodendroglioma 2850 4.8e-02
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.7
Disease Target Count Z-score Confidence
Glaucoma 239 6.348 3.2
Corneal disease 31 0.0 4.0

Expression

  Differential Expression (41)

Disease log2 FC p
acute quadriplegic myopathy 1.108 1.5e-03
adrenocortical carcinoma -1.275 1.3e-02
astrocytoma -1.400 1.1e-05
Breast cancer 1.100 3.9e-02
COPD 2.300 7.0e-03
cystic fibrosis -2.327 3.4e-05
diabetes mellitus -1.900 2.6e-02
ependymoma -1.500 3.0e-02
fascioscapulohumeral muscular dystrophy 1.171 1.9e-04
Gaucher disease type 1 -2.900 3.5e-02
group 4 medulloblastoma -1.400 4.1e-03
head and neck cancer and chronic obstruc... -2.100 2.8e-02
hepatocellular carcinoma 1.200 1.1e-02
interstitial cystitis -1.100 1.2e-02
intraductal papillary-mucinous adenoma (... -2.400 6.7e-03
intraductal papillary-mucinous carcinoma... -2.500 7.6e-03
intraductal papillary-mucinous neoplasm ... -2.500 3.8e-02
juvenile dermatomyositis 1.343 3.3e-07
limb girdle muscular dystrophy 2B 1.055 7.5e-03
lung adenocarcinoma 1.300 1.9e-08
lung cancer -1.700 2.9e-05
lung carcinoma -1.900 1.4e-10
malignant mesothelioma -3.300 1.3e-07
medulloblastoma, large-cell -1.400 3.5e-03
mucosa-associated lymphoid tissue lympho... 2.236 1.4e-02
non diabetic and post-ischemic heart fai... -2.100 1.2e-02
oligodendroglioma -1.100 4.8e-02
osteosarcoma 1.270 2.1e-02
ovarian cancer 2.200 8.5e-03
pancreatic cancer 2.000 1.5e-03
pancreatic carcinoma 2.000 1.5e-03
Pick disease 1.600 4.3e-03
pituitary cancer -2.100 1.8e-03
primary pancreatic ductal adenocarcinoma 1.736 4.6e-03
primary Sjogren syndrome 1.300 4.8e-04
psoriasis -1.800 7.4e-04
pulmonary arterial hypertension -1.200 4.5e-02
Rheumatoid arthritis 1.500 2.5e-02
subependymal giant cell astrocytoma 1.571 3.9e-02
tuberculosis -2.500 2.3e-05
ulcerative colitis 1.100 2.5e-02

Gene RIF (562)

AA Sequence

MGTSLSPNDPWPLNPLSIQQTTLLLLLSVLATVHVGQRLLRQRRRQLRSAPPGPFAWPLIGNAAAVGQAA      1 - 70
HLSFARLARRYGDVFQIRLGSCPIVVLNGERAIHQALVQQGSAFADRPAFASFRVVSGGRSMAFGHYSEH     71 - 140
WKVQRRAAHSMMRNFFTRQPRSRQVLEGHVLSEARELVALLVRGSADGAFLDPRPLTVVAVANVMSAVCF    141 - 210
GCRYSHDDPEFRELLSHNEEFGRTVGAGSLVDVMPWLQYFPNPVRTVFREFEQLNRNFSNFILDKFLRHC    211 - 280
ESLRPGAAPRDMMDAFILSAEKKAAGDSHGGGARLDLENVPATITDIFGASQDTLSTALQWLLLLFTRYP    281 - 350
DVQTRVQAELDQVVGRDRLPCMGDQPNLPYVLAFLYEAMRFSSFVPVTIPHATTANTSVLGYHIPKDTVV    351 - 420
FVNQWSVNHDPLKWPNPENFDPARFLDKDGLINKDLTSRVMIFSVGKRRCIGEELSKMQLFLFISILAHQ    421 - 490
CDFRANPNEPAKMNFSYGLTIKPKSFKVNVTLRESMELLDSAVQNLQAKETCQ                     491 - 543
//

Text Mined References (511)

PMID Year Title