Property Summary

NCBI Gene PubMed Count 474
Grant Count 342
R01 Count 245
Funding $36,257,947.63
PubMed Score 863.42
PubTator Score 1160.42

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (64)

Disease Z-score Confidence
Glaucoma 134 6.291 3.1
Cancer 2,346 5.087 2.5
Axenfeld-Rieger syndrome 11 4.172 2.1
Blindness 84 3.691 1.8
Aniridia 26 3.324 1.7
Acrofrontofacionasal dysostosis 4 3.036 1.5
Adenoma 165
Breast cancer 3,094
COPD 113
Cardiomegaly 66
Colorectal Neoplasms 217
Contact Dermatitis 80
Corneal disease 32 4.0
GLAUCOMA 1, OPEN ANGLE, A 3
GLAUCOMA 3, PRIMARY CONGENITAL, A 2
Gaucher disease type 1 171
Glaucoma, Primary Open Angle 5
Hydrophthalmos 2
Irido-corneo-trabecular dysgenesis (diso... 6 
Lung Neoplasms 171
Mammary Neoplasms 410
Melanoma 261
Mouth Neoplasms 42
Pick disease 1,893
Precursor Cell Lymphoblastic Leukemia Ly... 42 
Prostatic Neoplasms 471
Rheumatoid Arthritis 1,160
Squamous cell carcinoma 94
acute quadriplegic myopathy 1,157
adrenocortical carcinoma 1,427
astrocytoma 1,493
cystic fibrosis 1,665
diabetes mellitus 1,663
fascioscapulohumeral muscular dystrophy 100
group 4 medulloblastoma 1,875
hepatocellular carcinoma 532
interstitial cystitis 2,299
intraductal papillary-mucinous adenoma (... 2,956 
intraductal papillary-mucinous carcinoma... 2,988 
intraductal papillary-mucinous neoplasm ... 3,289 
juvenile dermatomyositis 1,189
limb girdle muscular dystrophy 2B 74
lung adenocarcinoma 2,713
lung cancer 4,466
lung carcinoma 2,844
malignant mesothelioma 3,162
medulloblastoma, large-cell 6,234
mucosa-associated lymphoid tissue lympho... 480 
non diabetic and post-ischemic heart fai... 200 
oligodendroglioma 2,849
osteosarcoma 7,933
ovarian cancer 8,484
ovarian neoplasm 97
pancreatic cancer 2,300
pancreatic carcinoma 567
pituitary cancer 1,972
posterior fossa group A ependymoma 1,511
primary Sjogren syndrome 789
primary pancreatic ductal adenocarcinoma 1,271
psoriasis 6,685
pulmonary arterial hypertension 36
subependymal giant cell astrocytoma 2,287
tuberculosis 1,557
ulcerative colitis 2,087

Expression

  Differential Expression (40)

Synonym

Accession Q16678 Q5TZW8 Q93089 Q9H316
Symbols CP1B
GLC3A
CYPIB1
P4501B1

Gene

PANTHER Protein Class (2)

PDB

3PM0  

Gene RIF (536)

PMID Text
26981862 data suggests that CYP1B1 promotes cell proliferation and metastasis by inducing EMT and Wnt/beta-catenin signaling via Sp1 induction
26681220 the single nucleotide polymorphisms rs180040 and rs1056827 of CYP1B1 showed an association with risk of primary open-angle glaucoma (Meta-Analysis)
26663047 Data show that the AS-PCR/RFLP assay has successfully constructed the haplotypes of the cytochrome P-450 CYP1B1 (CYP1B1) gene.
26647441 African-American women, the CYP1B1 SNP rs162561 was associated with right ventricular ejection fraction.
26626260 Results show that CYP1B1 may promote renal cell carcinoma development by inducing CDC20 expression and inhibiting apoptosis through the down-regulation of DAPK1.
26507668 CYP1B1 genetic polymorphisms may influence outcome of taxane therapy in Roma and Hungarian populations.
26466350 drugs acting as D2-dopamine receptor antagonists can modify several hormone systems that regulate the expression of CYP1A1, CYP1A2 and CYP1B1, and may affect the toxicity and carcinogenicity outcome of numerous toxicants and pre-carcinogenic substances
26225675 Leu432Val Polymorphism of CYP1B1 is Not Associated with Squamous Cell Carcinoma of Esophagus.
26198313 Data from pharmacogenomic studies suggest that SNPs in CYP1B1 or ABCB1 (ATP binding cassette subfamily B member 1) are responsible for taxane toxicity when used as chemotherapeutic agent in some women with breast cancer. [REVIEW]
26164761 This is the first ever report of a CYP1B1 variant segregating in a consanguineous family with co-existence of juvenile-onset open angle glaucoma and primary congenital glaucoma in two subsequent generations.
More...

AA Sequence

MGTSLSPNDPWPLNPLSIQQTTLLLLLSVLATVHVGQRLLRQRRRQLRSAPPGPFAWPLIGNAAAVGQAA      1 - 70
HLSFARLARRYGDVFQIRLGSCPIVVLNGERAIHQALVQQGSAFADRPAFASFRVVSGGRSMAFGHYSEH     71 - 140
WKVQRRAAHSMMRNFFTRQPRSRQVLEGHVLSEARELVALLVRGSADGAFLDPRPLTVVAVANVMSAVCF    141 - 210
GCRYSHDDPEFRELLSHNEEFGRTVGAGSLVDVMPWLQYFPNPVRTVFREFEQLNRNFSNFILDKFLRHC    211 - 280
ESLRPGAAPRDMMDAFILSAEKKAAGDSHGGGARLDLENVPATITDIFGASQDTLSTALQWLLLLFTRYP    281 - 350
DVQTRVQAELDQVVGRDRLPCMGDQPNLPYVLAFLYEAMRFSSFVPVTIPHATTANTSVLGYHIPKDTVV    351 - 420
FVNQWSVNHDPLKWPNPENFDPARFLDKDGLINKDLTSRVMIFSVGKRRCIGEELSKMQLFLFISILAHQ    421 - 490
CDFRANPNEPAKMNFSYGLTIKPKSFKVNVTLRESMELLDSAVQNLQAKETCQ                     491 - 543
//

Text Mined References (483)

PMID Year Title
26981862 2016 CYP1B1 Enhances Cell Proliferation and Metastasis through Induction of EMT and Activation of Wnt/?-Catenin Signaling via Sp1 Upregulation.
26681220 2015 Association of single nucleotide polymorphisms in the CYP1B1 gene with the risk of primary open-angle glaucoma: a meta-analysis.
26663047 2015 [Construction of CYP1B1 gene haplotypes predisposing to primary congenital glaucoma through allele-specific PCR/restriction fragment length polymorphism analysis].
26647441 2016 Oestradiol metabolism and androgen receptor genotypes are associated with right ventricular function.
26626260 2015 CYP1B1 promotes tumorigenesis via altered expression of CDC20 and DAPK1 genes in renal cell carcinoma.
26507668 2015 Interethnic differences of cytochrome P450 gene polymorphisms may influence outcome of taxane therapy in Roma and Hungarian populations.
26466350 2015 Dopamine D2-Receptor Antagonists Down-Regulate CYP1A1/2 and CYP1B1 in the Rat Liver.
26225675 2015 Leu432Val Polymorphism of CYP1B1 is Not Associated with Squamous Cell Carcinoma of Esophagus--a Case-Control Study from Kashmir, India.
26198313 2015 Are pharmacogenomic biomarkers an effective tool to predict taxane toxicity and outcome in breast cancer patients? Literature review.
26164761 2015 Homozygous p.G61E mutation in a consanguineous Pakistani family with co-existence of juvenile-onset open angle glaucoma and primary congenital glaucoma.
More...