Property Summary

NCBI Gene PubMed Count 10
PubMed Score 29.04
PubTator Score 16.09

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
psoriasis 6685 8.58330498283089E-35
glioblastoma multiforme 347 3.09501856208427E-17
astrocytoma 1493 1.32849523302669E-10
non-small cell lung cancer 2798 7.31235336213473E-10
cystic fibrosis 1670 1.29663298551776E-6
oligodendroglioma 2849 1.18487247026811E-5
Atopic dermatitis 944 5.83070139184841E-5
group 3 medulloblastoma 2254 8.08899087846593E-5
pancreatic cancer 2300 0.00111302879701558
pediatric high grade glioma 2712 0.00372105005880447
medulloblastoma, large-cell 6234 0.0201439847099846
primitive neuroectodermal tumor 3031 0.0213000812552365
Disease Target Count Z-score Confidence
Croup 12 3.403 1.7
Townes-Brocks syndrome 15 3.328 1.7

Expression

  Differential Expression (12)

Disease log2 FC p
psoriasis -1.400 0.000
astrocytoma 1.500 0.000
glioblastoma multiforme 1.800 0.000
oligodendroglioma 1.100 0.000
group 3 medulloblastoma 2.600 0.000
cystic fibrosis 1.621 0.000
medulloblastoma, large-cell 1.400 0.020
primitive neuroectodermal tumor 1.800 0.021
Atopic dermatitis -1.300 0.000
non-small cell lung cancer 2.184 0.000
pancreatic cancer 1.100 0.001
pediatric high grade glioma 1.700 0.004

Synonym

Accession Q16676 Q12949
Symbols FKHL8
FREAC4
FREAC-4

Gene

  Ortholog (2)

Species Source
Mouse OMA Inparanoid
Xenopus OMA Inparanoid

 GO Component (1)

Gene RIF (4)

PMID Text
25550559 Lung cancer patients with high FOXD1 expression survive for a significantly shorter time than those with low FOXD1 expression.
25462566 FOXD1 promotes breast cancer proliferation and chemotherapeutic drug resistance by targeting p27
24099863 In this review, we focus on the role of four specific FOX factors (FOXD1, FOXL2, FOXO1 and FOXP3) in gonadotropin hormone production
15716278 the level of Smad6s can alter the level of TGF-beta and the subsequent induction of PAI-1 via a FoxD1 transcription site

AA Sequence

MTLSTEMSDASGLAEETDIDVVGEGEDEEDEEEEDDDEGGGGGPRLAVPAQRRRRRRSYAGEDELEDLEE      1 - 70
EEDDDDILLAPPAGGSPAPPGPAPAAGAGAGGGGGGGGAGGGGSAGSGAKNPLVKPPYSYIALITMAILQ     71 - 140
SPKKRLTLSEICEFISGRFPYYREKFPAWQNSIRHNLSLNDCFVKIPREPGNPGKGNYWTLDPESADMFD    141 - 210
NGSFLRRRKRFKRQPLLPPNAAAAESLLLRGAGAAGGAGDPAAAAALFPPAPPPPPHAYGYGPYGCGYGL    211 - 280
QLPPYAPPSALFAAAAAAAAAAAFHPHSPPPPPPPHGAAAELARTAFGYRPHPLGAALPGPLPASAAKAG    281 - 350
GPGASALARSPFSIESIIGGSLGPAAAAAAAAQAAAAAQASPSPSPVAAPPAPGSSGGGCAAQAAVGPAA    351 - 420
ALTRSLVAAAAAAASSVSSSAALGTLHQGTALSSVENFTARISNC                             421 - 465
//

Text Mined References (10)

PMID Year Title
25550559 2015 FOXD1 expression is associated with poor prognosis in non-small cell lung cancer.
25462566 2015 FOXD1 promotes breast cancer proliferation and chemotherapeutic drug resistance by targeting p27.
24099863 2014 Fox tales: regulation of gonadotropin gene expression by forkhead transcription factors.
19626042 2009 Identification and analysis of the human CD160 promoter: implication of a potential AML-1 binding site in promoter activation.
16585573 2006 Coordination of NF-kappaB and NFAT antagonism by the forkhead transcription factor Foxd1.
15716278 2005 Smad6s regulates plasminogen activator inhibitor-1 through a protein kinase C-beta-dependent up-regulation of transforming growth factor-beta.
15492844 2004 Human FOX gene family (Review).
8825632 1995 Chromosomal localization of six human forkhead genes, freac-1 (FKHL5), -3 (FKHL7), -4 (FKHL8), -5 (FKHL9), -6 (FKHL10), and -8 (FKHL12).
8702877 1996 Characterization of the human forkhead gene FREAC-4. Evidence for regulation by Wilms' tumor suppressor gene (WT-1) and p53.
7957066 1994 Cloning and characterization of seven human forkhead proteins: binding site specificity and DNA bending.