Property Summary

NCBI Gene PubMed Count 13
PubMed Score 33.11
PubTator Score 16.09

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Disease log2 FC p
adult high grade glioma 1.700 2.5e-04
astrocytoma 1.500 1.3e-10
Atopic dermatitis -1.300 5.8e-05
cystic fibrosis 1.621 1.3e-06
glioblastoma 1.800 1.6e-04
group 3 medulloblastoma 2.600 8.1e-05
medulloblastoma, large-cell 1.400 2.0e-02
non-small cell lung cancer 2.184 7.3e-10
oligodendroglioma 1.100 1.2e-05
pancreatic cancer 1.100 1.1e-03
primitive neuroectodermal tumor 1.800 2.1e-02
psoriasis -1.300 1.8e-02

 GO Component (1)

Gene RIF (7)

AA Sequence

MTLSTEMSDASGLAEETDIDVVGEGEDEEDEEEEDDDEGGGGGPRLAVPAQRRRRRRSYAGEDELEDLEE      1 - 70
EEDDDDILLAPPAGGSPAPPGPAPAAGAGAGGGGGGGGAGGGGSAGSGAKNPLVKPPYSYIALITMAILQ     71 - 140
SPKKRLTLSEICEFISGRFPYYREKFPAWQNSIRHNLSLNDCFVKIPREPGNPGKGNYWTLDPESADMFD    141 - 210
NGSFLRRRKRFKRQPLLPPNAAAAESLLLRGAGAAGGAGDPAAAAALFPPAPPPPPHAYGYGPYGCGYGL    211 - 280
QLPPYAPPSALFAAAAAAAAAAAFHPHSPPPPPPPHGAAAELARTAFGYRPHPLGAALPGPLPASAAKAG    281 - 350
GPGASALARSPFSIESIIGGSLGPAAAAAAAAQAAAAAQASPSPSPVAAPPAPGSSGGGCAAQAAVGPAA    351 - 420
ALTRSLVAAAAAAASSVSSSAALGTLHQGTALSSVENFTARISNC                             421 - 465
//

Text Mined References (13)

PMID Year Title