Property Summary

NCBI Gene PubMed Count 49
PubMed Score 104.39
PubTator Score 114.31

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count Z-score Confidence
Stomach Neoplasms 300 0.0 0.0
Disease Target Count Z-score Confidence
Melanoma 711 5.248 2.6
Uveal melanoma 20 4.249 2.1
Skin cancer 469 3.243 1.6

Expression

Gene RIF (37)

AA Sequence

MARSLVCLGVIILLSAFSGPGVRGGPMPKLADRKLCADQECSHPISMAVALQDYMAPDCRFLTIHRGQVV      1 - 70
YVFSKLKGRGRLFWGGSVQGDYYGDLAARLGYFPSSIVREDQTLKPGKVDVKTDKWDFYCQ              71 - 131
//

Text Mined References (50)

PMID Year Title