Property Summary

NCBI Gene PubMed Count 44
Grant Count 43
R01 Count 36
Funding $4,053,208
PubMed Score 99.49
PubTator Score 114.31

Knowledge Summary

Patent

No data available

Expression

Gene RIF (32)

PMID Text
24608986 data provide evidence for a critical role of SOX10 in melanoma cell invasion through the regulation of MIA and highlight its role as a therapeutic target in melanoma
24372647 Focus on the quantitative analysis of the MIA protein as a prognostic tool because it has proven to be a useful serum marker for documenting disease progression of malignant melanoma. Review.
24349210 The effects of MIA/CD-RAP on transcriptional regulation in chondrocytes, through the regulation of p54(nrb) via YBX1 contributes to the understanding of chondrogenesis.
23672612 Functional promoter analysis identified the transcription factor YBX1 as the mediator of MIA activation of p54(nrb) transcription.
23664187 MIA protein is present in non-segmental vitiligo skin and may cause the detachment of melanocytes; its target is integrin alpha5beta1, which determines the breaking and/or weakening of connections among melanocytes and basal membrane
21858537 Results show that S-100B, MIA and LDH levels were significantly higher in patients with advanced melanoma than in disease-free patients or healthy controls.
21658116 assessed the utility of melanoma inhibitory activity (MIA) serum marker in the follow up and primary diagnosis of stage III melanoma patients
21540751 Further diagnostics should be initiated in uveal melanoma patients with serum MIA above 8.3ng/ml.
21487066 Data suggest that plasma markers: CEACAM, ICAM-1, osteopontin, MIA, TIMP-1 and S100B particularly when assessed in combination, can be used to monitor patients for disease recurrenc.
21277254 The cell-specific production rate of MIA was quantitatively proportional to the aggrecan gene expression level in the early and middle phase of cartilage chondrocyte differentiation.
More...

AA Sequence

MARSLVCLGVIILLSAFSGPGVRGGPMPKLADRKLCADQECSHPISMAVALQDYMAPDCRFLTIHRGQVV      1 - 70
YVFSKLKGRGRLFWGGSVQGDYYGDLAARLGYFPSSIVREDQTLKPGKVDVKTDKWDFYCQ              71 - 131
//

Text Mined References (45)

PMID Year Title
24608986 2014 SOX10 promotes melanoma cell invasion by regulating melanoma inhibitory activity.
24372647 2014 Melanoma inhibitory activity in melanoma diagnostics and therapy - a small protein is looming large.
24349210 2013 YBX1 is a modulator of MIA/CD-RAP-dependent chondrogenesis.
23672612 2013 Melanoma inhibitory activity promotes melanoma development through activation of YBX1.
23664187 2013 Role of alpha5beta1 integrin and MIA (melanoma inhibitory activity) in the pathogenesis of vitiligo.
22446962 2012 A genome-wide association study identifies three new risk loci for Kawasaki disease.
22419821 2012 Identification of IGPR-1 as a novel adhesion molecule involved in angiogenesis.
22081228 2011 Genome-wide association study identifies FCGR2A as a susceptibility locus for Kawasaki disease.
21858537 2011 Evaluation of multiple serum markers in advanced melanoma.
21658116 2011 Impact of lymph node metastases on serum level of melanoma inhibitory activity in stage III melanoma patients.
More...