Property Summary

NCBI Gene PubMed Count 61
PubMed Score 117.92
PubTator Score 61.66

Knowledge Summary

Patent (5,102)

Expression

  Differential Expression (2)

Disease log2 FC p
facioscapulohumeral dystrophy 2.200 1.2e-03
pituitary cancer 1.200 2.0e-05

Gene RIF (49)

AA Sequence

MLGSLGLWALLPTAVEAPPNRRTCVFFEAPGVRGSTKTLGELLDTGTELPRAIRCLYSRCCFGIWNLTQD      1 - 70
RAQVEMQGCRDSDEPGCESLHCDPSPRAHPSPGSTLFTCSCGTDFCNANYSHLPPPGSPGTPGSQGPQAA     71 - 140
PGESIWMALVLLGLFLLLLLLLGSIILALLQRKNYRVRGEPVPEPRPDSGRDWSVELQELPELCFSQVIR    141 - 210
EGGHAVVWAGQLQGKLVAIKAFPPRSVAQFQAERALYELPGLQHDHIVRFITASRGGPGRLLSGPLLVLE    211 - 280
LHPKGSLCHYLTQYTSDWGSSLRMALSLAQGLAFLHEERWQNGQYKPGIAHRDLSSQNVLIREDGSCAIG    281 - 350
DLGLALVLPGLTQPPAWTPTQPQGPAAIMEAGTQRYMAPELLDKTLDLQDWGMALRRADIYSLALLLWEI    351 - 420
LSRCPDLRPDSSPPPFQLAYEAELGNTPTSDELWALAVQERRRPYIPSTWRCFATDPDGLRELLEDCWDA    421 - 490
DPEARLTAECVQQRLAALAHPQESHPFPESCPRGCPPLCPEDCTSIPAPTILPCRPQRSACHFSVQQGPC    491 - 560
SRNPQPACTLSPV                                                             561 - 573
//

Text Mined References (63)

PMID Year Title