Property Summary

NCBI Gene PubMed Count 53
Grant Count 55
R01 Count 31
Funding $8,266,104.96
PubMed Score 104.05
PubTator Score 61.66

Knowledge Summary

Patent (5,102)

Expression

  Differential Expression (2)

Disease log2 FC p
pituitary cancer 1.200 0.000
facioscapulohumeral dystrophy 2.200 0.001

Synonym

Accession Q16671 A0AVE1 B9EGB7 E9PGD2 F8W1D2 Q13762 Q647K2
Symbols AMHR
MRII
MISR2
MISRII

Gene

Gene RIF (41)

PMID Text
26848671 Neither AMH nor AMHR2 polymorphisms were related to age, BMI, hormone levels or ovarian parameters in the follicular phase in women of late reproductive stage.
26753790 A significant subset of GnRH neurons express the AMH receptor.
26464718 There is no association between single nucleotide polymorphisms in the AMH/AMHR2 signaling pathway and early ovarian hyperstimulation syndrome in Han Chinese women
25972076 study demonstrated for the first time that human placenta and fetal membranes express and co-localize Anti-Mullerian hormone(AMH) and Anti-Mullerian hormone Receptor II
25790842 AMHR2 rs11170555 and rs3741664 were positively associated with AMH, estradiol and FSH levels.
25663701 A significant portion of AMHRII was missing most of its extracellular domain (ECD) and was unfolded and retained in the endoplasmic reticulum.
25542251 There was evidence that in specific subgroups of women undergoing IVF/ICSI, AMH and AMHRII SNPs may be related to patients' characteristics and controlled ovarian stimulation and pregnancy outcome
25517316 Data indicate that Muellerian inhibiting substance type II receptor (MISRII) is a promising target for the control of ovarian granulosa cell tumors (GCT) and epithelial ovarian cancers (EOC).
24912417 These findings suggest that patients with primary ovarian insufficiency in China share AMH and AMHR2 genetic variants with those who go through menopause at a normal age.
24613539 Antimullerian hormone receptor expression is increased in endometrium from patients with endometriosis.
More...

AA Sequence

MLGSLGLWALLPTAVEAPPNRRTCVFFEAPGVRGSTKTLGELLDTGTELPRAIRCLYSRCCFGIWNLTQD      1 - 70
RAQVEMQGCRDSDEPGCESLHCDPSPRAHPSPGSTLFTCSCGTDFCNANYSHLPPPGSPGTPGSQGPQAA     71 - 140
PGESIWMALVLLGLFLLLLLLLGSIILALLQRKNYRVRGEPVPEPRPDSGRDWSVELQELPELCFSQVIR    141 - 210
EGGHAVVWAGQLQGKLVAIKAFPPRSVAQFQAERALYELPGLQHDHIVRFITASRGGPGRLLSGPLLVLE    211 - 280
LHPKGSLCHYLTQYTSDWGSSLRMALSLAQGLAFLHEERWQNGQYKPGIAHRDLSSQNVLIREDGSCAIG    281 - 350
DLGLALVLPGLTQPPAWTPTQPQGPAAIMEAGTQRYMAPELLDKTLDLQDWGMALRRADIYSLALLLWEI    351 - 420
LSRCPDLRPDSSPPPFQLAYEAELGNTPTSDELWALAVQERRRPYIPSTWRCFATDPDGLRELLEDCWDA    421 - 490
DPEARLTAECVQQRLAALAHPQESHPFPESCPRGCPPLCPEDCTSIPAPTILPCRPQRSACHFSVQQGPC    491 - 560
SRNPQPACTLSPV                                                             561 - 573
//

Text Mined References (55)

PMID Year Title
27430550 2016 A dominant negative mutation at the ATP binding domain of AMHR2 is associated with a defective anti-Müllerian hormone signaling pathway.
26848671 2016 The Relationship between AMH and AMHR2 Polymorphisms and the Follicular Phase in Late Reproductive Stage Women.
26753790 2016 Novel role for anti-Müllerian hormone in the regulation of GnRH neuron excitability and hormone secretion.
26464718 2015 Possible involvement of single nucleotide polymorphisms in anti-Müllerian hormone signaling pathway in the pathogenesis of early OHSS in Han Chinese women.
25972076 2015 Placenta expresses anti-Müllerian hormone and its receptor: Sex-related difference in fetal membranes.
25790842 2015 AMH and AMHR2 polymorphisms and AMH serum level can predict assisted reproduction outcomes: a cross-sectional study.
25663701 2015 Constitutive negative regulation in the processing of the anti-Müllerian hormone receptor II.
25542251 2015 Single nucleotide polymorphisms in the Anti-Müllerian hormone (AMH Ile(49)Ser) and Anti-Müllerian hormone type II receptor (AMHRII -482 A>G) as genetic markers in assisted reproduction technology.
25517316 2014 The human Müllerian inhibiting substance type II receptor as immunotherapy target for ovarian cancer. Validation using the mAb 12G4.
24912417 2014 AMH and AMHR2 genetic variants in Chinese women with primary ovarian insufficiency and normal age at natural menopause.
More...