Property Summary

NCBI Gene PubMed Count 40
Grant Count 25
R01 Count 19
Funding $1,437,647.08
PubMed Score 39.41
PubTator Score 433.00

Knowledge Summary

Patent

No data available

Expression

Gene RIF (22)

PMID Text
26586430 Knockdown of Cdkn3 stabilizes Mps1 at centrosomes.
26554648 CDKN3 overexpression in lung adenocarcinoma is not attributed to alternative splicing or mutation but is likely due to increased mitotic activity, arguing against CDKN3 as a tumour suppressor
26372210 CDKN3 mRNA may be a good survival biomarker and potential therapeutic target in cervical cancer
26191143 CDKN3 knockdown reduces cell proliferation, invasion and promotes apoptosis in human ovarian cancer cells.
25735390 High CDKN3 expression is associated with colorectal cancer.
25360622 These results highlight the importance of CDKN3 in Bcr-Abl-mediated leukemogenesis.
24704824 these data identify KAP as a major regulator of cell division via interactions with numerous target proteins. aberrant splicing or miR-26a decreases KAP expression to promote glioblastoma growth and invasion.
24573179 CDKN3 may play an important role in the development and proliferation of epithelial ovarian cancer
23775190 CDKN3 controls mitosis through the CDC2 signaling axis.
23555623 RelB activation is key for promoting multiple myeloma cell survival through the upregulation of anti-apoptotic proteins, in particular, CIAP2.
More...

AA Sequence

MKPPSSIQTSEFDSSDEEPIEDEQTPIHISWLSLSRVNCSQFLGLCALPGCKFKDVRRNVQKDTEELKSC      1 - 70
GIQDIFVFCTRGELSKYRVPNLLDLYQQCGIITHHHPIADGGTPDIASCCEIMEELTTCLKNYRKTLIHC     71 - 140
YGGLGRSCLVAACLLLYLSDTISPEQAIDSLRDLRGSGAIQTIKQYNYLHEFRDKLAAHLSSRDSQSRSV    141 - 210
SR                                                                        211 - 212
//

Text Mined References (41)

PMID Year Title
26586430 2015 The Tumor Suppressor Cdkn3 Is Required for Maintaining the Proper Number of Centrosomes by Regulating the Centrosomal Stability of Mps1.
26554648 2015 Overexpression of major CDKN3 transcripts is associated with poor survival in lung adenocarcinoma.
26372210 2015 CDKN3 mRNA as a Biomarker for Survival and Therapeutic Target in Cervical Cancer.
26191143 2015 CDKN3 knockdown reduces cell proliferation, invasion and promotes apoptosis in human ovarian cancer.
25852190 2015 Integrative analysis of kinase networks in TRAIL-induced apoptosis provides a source of potential targets for combination therapy.
25735390 2015 Mechanistic studies of cyclin-dependent kinase inhibitor 3 (CDKN3) in colorectal cancer.
25360622 2014 A critical role of CDKN3 in Bcr-Abl-mediated tumorigenesis.
24704824 2015 KAP regulates ROCK2 and Cdk2 in an RNA-activated glioblastoma invasion pathway.
24573179 2014 CDKN3 is an independent prognostic factor and promotes ovarian carcinoma cell proliferation in ovarian cancer.
24218572 2013 CDK10/cyclin M is a protein kinase that controls ETS2 degradation and is deficient in STAR syndrome.
More...