Property Summary

NCBI Gene PubMed Count 45
PubMed Score 41.33
PubTator Score 433.00

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (28)

Disease log2 FC p
acute myeloid leukemia -1.200 4.4e-02
adrenocortical carcinoma 3.638 7.6e-08
astrocytic glioma -1.300 9.2e-03
Atopic dermatitis 1.400 1.3e-03
atypical teratoid / rhabdoid tumor 2.100 1.3e-06
Breast cancer 2.300 1.5e-11
breast carcinoma 1.500 1.1e-38
ductal carcinoma in situ 2.700 2.2e-04
Endometriosis 1.911 1.5e-02
ependymoma -1.200 3.5e-02
glioblastoma 1.900 7.8e-08
group 3 medulloblastoma 3.200 3.1e-07
interstitial cystitis 2.400 1.3e-03
intraductal papillary-mucinous carcinoma... 1.700 3.7e-04
intraductal papillary-mucinous neoplasm ... 2.700 7.6e-04
invasive ductal carcinoma 3.300 4.3e-05
lung adenocarcinoma 1.100 1.5e-06
lung cancer 4.500 2.1e-07
malignant mesothelioma 1.200 3.0e-06
medulloblastoma, large-cell 2.800 5.0e-07
non-small cell lung cancer 3.311 1.4e-30
oligodendroglioma -1.400 5.6e-03
ovarian cancer 1.400 1.6e-03
pancreatic cancer 1.200 1.8e-03
pediatric high grade glioma 2.000 6.2e-06
primitive neuroectodermal tumor 1.900 1.1e-03
psoriasis 2.000 4.5e-39
ulcerative colitis 1.100 3.2e-04

Gene RIF (26)

AA Sequence

MKPPSSIQTSEFDSSDEEPIEDEQTPIHISWLSLSRVNCSQFLGLCALPGCKFKDVRRNVQKDTEELKSC      1 - 70
GIQDIFVFCTRGELSKYRVPNLLDLYQQCGIITHHHPIADGGTPDIASCCEIMEELTTCLKNYRKTLIHC     71 - 140
YGGLGRSCLVAACLLLYLSDTISPEQAIDSLRDLRGSGAIQTIKQYNYLHEFRDKLAAHLSSRDSQSRSV    141 - 210
SR                                                                        211 - 212
//

Text Mined References (46)

PMID Year Title