Property Summary

NCBI Gene PubMed Count 111
PubMed Score 106.14
PubTator Score 116.92

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (3)

Disease Target Count
Obesity 616
Disease Target Count P-value
lung carcinoma 2844 4.42990874045251E-27
juvenile dermatomyositis 1189 1.52587269171022E-18
Duchenne muscular dystrophy 602 2.57093408987987E-10
pediatric high grade glioma 2712 3.14774538829844E-10
ovarian cancer 8492 2.8512735410957E-9
pilocytic astrocytoma 3086 3.39558849054161E-9
ulcerative colitis 2087 1.21807270821926E-8
psoriasis 6685 1.69013037976941E-8
glioblastoma 5572 2.12081612174303E-7
lung cancer 4473 4.96289039223209E-6
osteosarcoma 7933 1.01292865849898E-5
oligodendroglioma 2849 1.09774669927529E-5
group 4 medulloblastoma 1875 3.51243649450462E-5
cystic fibrosis 1670 5.97155159231031E-5
Breast cancer 3099 7.01199682875814E-5
acute quadriplegic myopathy 1157 1.25664792027444E-4
nephrosclerosis 329 2.38917568397612E-4
medulloblastoma, large-cell 6234 2.5087810703285E-4
cutaneous lupus erythematosus 1056 3.50083539373607E-4
Multiple myeloma 1328 5.36222431609031E-4
posterior fossa group A ependymoma 1511 6.81562651340609E-4
active Crohn's disease 918 7.73558218545843E-4
pancreatic cancer 2300 9.14939309732492E-4
subependymal giant cell astrocytoma 2287 9.64270084714121E-4
dermatomyositis 967 9.67268884109241E-4
primary Sjogren syndrome 789 0.00158716799497136
Becker muscular dystrophy 187 0.00329277330795552
limb girdle muscular dystrophy 2B 74 0.00440096989503328
autosomal dominant Emery-Dreifuss muscular dystrophy 499 0.00478577613052311
primary pancreatic ductal adenocarcinoma 1271 0.00551840269029899
systemic lupus erythematosus 172 0.00583846464324377
Multiple Sclerosis 498 0.00608191957420325
aldosterone-producing adenoma 664 0.00703747310963797
Down syndrome 548 0.0085551935704254
lung adenocarcinoma 2714 0.0133668738099906
Waldenstrons macroglobulinemia 765 0.0183572484710677
astrocytoma 1493 0.0184409926623673
Pick disease 1893 0.0197854062070526
diabetes mellitus 1663 0.0276969554916807
intraductal papillary-mucinous adenoma (IPMA) 2956 0.0281573746030407
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.0314690231236009
gastric carcinoma 832 0.0427750026073483
primitive neuroectodermal tumor 3031 0.0453622444643705
Disease Target Count Z-score Confidence
Hypersensitivity reaction type II disease 235 0.0 1.0

Expression

  Differential Expression (43)

Disease log2 FC p
systemic lupus erythematosus 1.200 0.006
nephrosclerosis 1.051 0.000
Waldenstrons macroglobulinemia 1.451 0.018
Multiple myeloma 2.176 0.001
astrocytoma 2.100 0.018
psoriasis 2.100 0.000
cutaneous lupus erythematosus 1.400 0.000
glioblastoma 3.200 0.000
oligodendroglioma 1.300 0.000
osteosarcoma 2.112 0.000
cystic fibrosis 1.211 0.000
medulloblastoma, large-cell -2.200 0.000
primitive neuroectodermal tumor 1.500 0.045
Duchenne muscular dystrophy 2.291 0.000
limb girdle muscular dystrophy 2B 1.219 0.004
autosomal dominant Emery-Dreifuss muscul... 1.426 0.005
Becker muscular dystrophy 1.415 0.003
juvenile dermatomyositis 3.398 0.000
acute quadriplegic myopathy 1.649 0.000
primary pancreatic ductal adenocarcinoma 1.725 0.006
intraductal papillary-mucinous adenoma (... 1.100 0.028
intraductal papillary-mucinous neoplasm ... 1.400 0.031
lung cancer -2.200 0.000
active Crohn's disease 3.147 0.001
ulcerative colitis 3.400 0.000
pancreatic cancer 1.800 0.001
diabetes mellitus -1.100 0.028
Multiple Sclerosis 1.100 0.006
pediatric high grade glioma 3.200 0.000
group 4 medulloblastoma -1.900 0.000
pilocytic astrocytoma 2.900 0.000
posterior fossa group A ependymoma 1.200 0.001
primary Sjogren syndrome 2.400 0.002
aldosterone-producing adenoma -1.142 0.007
subependymal giant cell astrocytoma 3.263 0.001
lung adenocarcinoma 1.142 0.013
lung carcinoma -2.300 0.000
Pick disease 1.100 0.020
Breast cancer -1.400 0.000
gastric carcinoma 1.500 0.043
ovarian cancer -3.300 0.000
Down syndrome 1.500 0.009
dermatomyositis 2.700 0.001

Gene

PANTHER Protein Class (1)

PDB

2OQ0   3B6Y   3RLN   3RLO   3RNU   4QGU  

  Ortholog (3)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse EggNOG Inparanoid

 MGI Term (1)

Gene RIF (86)

PMID Text
26468536 Studies of the dynamics of the response of PML nuclear body components and IFI16 to invading herpes simplex virus 1 genomes demonstrated that human Daxx (hDaxx) and IFI16 respond more rapidly than PML.
26362536 HIV-1 Gag interacts with IfI16 as demonstrated by proximity dependent biotinylation proteomics
26316393 High levels of circulating IFI16 in rheumatoid arthritis are more frequent in RF/anti-CCP-positive RA patients and significantly associated with pulmonary involvement.
26313692 A significant upregulation of the PYHIN inflammasomes AIM2 and IFI16 in active inflammatory bowel disease versus controls was found.
26271464 IFI16 sera concentration was directly correlated with disease duration and inversely correlated with age at diagnosis of Sjogren's syndrome.
26185770 IFI16 gene expression directly correlated with NF-kappaB activation, indicating that IFI16 could be considered an upstream modulator of NF-kappaB in human B-cells.
26134128 increased nuclear acetylation of IFI16 is a dynamic essential post-genome recognition event in the nucleus that is common to the IFI16-mediated innate responses of inflammasome induction and IFN-beta production during herpesvirus infections
26121674 BRCA1 is a constituent of the triggered IFI16-inflammasome and is translocated into the cytoplasm after genome recognition along with the IFI16-inflammasome
26037655 antibodies prominent in primary Sjogren's syndrome
26002845 These findings demonstrate that IFI16 plays a critical role in fms-like tyrosine kinase 1 and soluble endoglin production in human trophoblast cells.
More...

AA Sequence

MGKKYKNIVLLKGLEVINDYHFRMVKSLLSNDLKLNLKMREEYDKIQIADLMEEKFRGDAGLGKLIKIFE      1 - 70
DIPTLEDLAETLKKEKLKVKGPALSRKRKKEVDATSPAPSTSSTVKTEGAEATPGAQKRKKSTKEKAGPK     71 - 140
GSKVSEEQTQPPSPAGAGMSTAMGRSPSPKTSLSAPPNSSSTENPKTVAKCQVTPRRNVLQKRPVIVKVL    141 - 210
STTKPFEYETPEMEKKIMFHATVATQTQFFHVKVLNTSLKEKFNGKKIIIISDYLEYDSLLEVNEESTVS    211 - 280
EAGPNQTFEVPNKIINRAKETLKIDILHKQASGNIVYGVFMLHKKTVNQKTTIYEIQDDRGKMDVVGTGQ    281 - 350
CHNIPCEEGDKLQLFCFRLRKKNQMSKLISEMHSFIQIKKKTNPRNNDPKSMKLPQEQRQLPYPSEASTT    351 - 420
FPESHLRTPQMPPTTPSSSFFTKKSEDTISKMNDFMRMQILKEGSHFPGPFMTSIGPAESHPHTPQMPPS    421 - 490
TPSSSFLTTKSEDTISKMNDFMRMQILKEGSHFPGPFMTSIGPAESHPHTPQMPPSTPSSSFLTTLKPRL    491 - 560
KTEPEEVSIEDSAQSDLKEVMVLNATESFVYEPKEQKKMFHATVATENEVFRVKVFNIDLKEKFTPKKII    561 - 630
AIANYVCRNGFLEVYPFTLVADVNADRNMEIPKGLIRSASVTPKINQLCSQTKGSFVNGVFEVHKKNVRG    631 - 700
EFTYYEIQDNTGKMEVVVHGRLTTINCEEGDKLKLTCFELAPKSGNTGELRSVIHSHIKVIKTRKNKKDI    701 - 770
LNPDSSMETSPDFFF                                                           771 - 785
//

Text Mined References (122)

PMID Year Title
26468536 2015 Dynamic Response of IFI16 and Promyelocytic Leukemia Nuclear Body Components to Herpes Simplex Virus 1 Infection.
26316393 2016 Circulating Interferon-Inducible Protein IFI16 Correlates With Clinical and Serological Features in Rheumatoid Arthritis.
26313692 2015 Strong Upregulation of AIM2 and IFI16 Inflammasomes in the Mucosa of Patients with Active Inflammatory Bowel Disease.
26271464 2015 Interferon gamma-inducible protein 16 in primary Sjögren's syndrome: a novel player in disease pathogenesis?
26185770 2015 IFI16 Expression Is Related to Selected Transcription Factors during B-Cell Differentiation.
26134128 2015 Herpesvirus Genome Recognition Induced Acetylation of Nuclear IFI16 Is Essential for Its Cytoplasmic Translocation, Inflammasome and IFN-? Responses.
26121674 2015 BRCA1 Regulates IFI16 Mediated Nuclear Innate Sensing of Herpes Viral DNA and Subsequent Induction of the Innate Inflammasome and Interferon-? Responses.
26037655 2016 Association of Antibodies to Interferon-Inducible Protein-16 With Markers of More Severe Disease in Primary Sjögren's Syndrome.
26002845 2015 IFI16 mediates soluble Flt-1 and endoglin production by trophoblast cells.
25972554 2015 The Nuclear DNA Sensor IFI16 Acts as a Restriction Factor for Human Papillomavirus Replication through Epigenetic Modifications of the Viral Promoters.
More...