Property Summary

NCBI Gene PubMed Count 111
Grant Count 44
R01 Count 30
Funding $3,358,428.33
PubMed Score 106.14
PubTator Score 116.92

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (43)

Disease log2 FC p
systemic lupus erythematosus 1.200 0.006
nephrosclerosis 1.051 0.000
Waldenstrons macroglobulinemia 1.451 0.018
Multiple myeloma 2.176 0.001
astrocytoma 2.100 0.018
psoriasis 2.100 0.000
cutaneous lupus erythematosus 1.400 0.000
glioblastoma 3.200 0.000
oligodendroglioma 1.300 0.000
osteosarcoma 2.112 0.000
cystic fibrosis 1.211 0.000
medulloblastoma, large-cell -2.200 0.000
primitive neuroectodermal tumor 1.500 0.045
Duchenne muscular dystrophy 2.291 0.000
limb girdle muscular dystrophy 2B 1.219 0.004
autosomal dominant Emery-Dreifuss muscul... 1.426 0.005
Becker muscular dystrophy 1.415 0.003
juvenile dermatomyositis 3.398 0.000
acute quadriplegic myopathy 1.649 0.000
primary pancreatic ductal adenocarcinoma 1.725 0.006
intraductal papillary-mucinous adenoma (... 1.100 0.028
intraductal papillary-mucinous neoplasm ... 1.400 0.031
lung cancer -2.200 0.000
active Crohn's disease 3.147 0.001
ulcerative colitis 3.400 0.000
pancreatic cancer 1.800 0.001
diabetes mellitus -1.100 0.028
Multiple Sclerosis 1.100 0.006
pediatric high grade glioma 3.200 0.000
group 4 medulloblastoma -1.900 0.000
pilocytic astrocytoma 2.900 0.000
posterior fossa group A ependymoma 1.200 0.001
primary Sjogren syndrome 2.400 0.002
aldosterone-producing adenoma -1.142 0.007
subependymal giant cell astrocytoma 3.263 0.001
lung adenocarcinoma 1.142 0.013
lung carcinoma -2.300 0.000
Pick disease 1.100 0.020
Breast cancer -1.400 0.000
gastric carcinoma 1.500 0.043
ovarian cancer -3.300 0.000
Down syndrome 1.500 0.009
dermatomyositis 2.700 0.001

Gene RIF (88)

PMID Text
26468536 Studies of the dynamics of the response of PML nuclear body components and IFI16 to invading herpes simplex virus 1 genomes demonstrated that human Daxx (hDaxx) and IFI16 respond more rapidly than PML.
26362536 HIV-1 Gag interacts with IfI16 as demonstrated by proximity dependent biotinylation proteomics
26316393 High levels of circulating IFI16 in rheumatoid arthritis are more frequent in RF/anti-CCP-positive RA patients and significantly associated with pulmonary involvement.
26313692 A significant upregulation of the PYHIN inflammasomes AIM2 and IFI16 in active inflammatory bowel disease versus controls was found.
26271464 IFI16 sera concentration was directly correlated with disease duration and inversely correlated with age at diagnosis of Sjogren's syndrome.
26185770 IFI16 gene expression directly correlated with NF-kappaB activation, indicating that IFI16 could be considered an upstream modulator of NF-kappaB in human B-cells.
26134128 increased nuclear acetylation of IFI16 is a dynamic essential post-genome recognition event in the nucleus that is common to the IFI16-mediated innate responses of inflammasome induction and IFN-beta production during herpesvirus infections
26121674 BRCA1 is a constituent of the triggered IFI16-inflammasome and is translocated into the cytoplasm after genome recognition along with the IFI16-inflammasome
26037655 antibodies prominent in primary Sjogren's syndrome
26002845 These findings demonstrate that IFI16 plays a critical role in fms-like tyrosine kinase 1 and soluble endoglin production in human trophoblast cells.
More...

AA Sequence

MGKKYKNIVLLKGLEVINDYHFRMVKSLLSNDLKLNLKMREEYDKIQIADLMEEKFRGDAGLGKLIKIFE      1 - 70
DIPTLEDLAETLKKEKLKVKGPALSRKRKKEVDATSPAPSTSSTVKTEGAEATPGAQKRKKSTKEKAGPK     71 - 140
GSKVSEEQTQPPSPAGAGMSTAMGRSPSPKTSLSAPPNSSSTENPKTVAKCQVTPRRNVLQKRPVIVKVL    141 - 210
STTKPFEYETPEMEKKIMFHATVATQTQFFHVKVLNTSLKEKFNGKKIIIISDYLEYDSLLEVNEESTVS    211 - 280
EAGPNQTFEVPNKIINRAKETLKIDILHKQASGNIVYGVFMLHKKTVNQKTTIYEIQDDRGKMDVVGTGQ    281 - 350
CHNIPCEEGDKLQLFCFRLRKKNQMSKLISEMHSFIQIKKKTNPRNNDPKSMKLPQEQRQLPYPSEASTT    351 - 420
FPESHLRTPQMPPTTPSSSFFTKKSEDTISKMNDFMRMQILKEGSHFPGPFMTSIGPAESHPHTPQMPPS    421 - 490
TPSSSFLTTKSEDTISKMNDFMRMQILKEGSHFPGPFMTSIGPAESHPHTPQMPPSTPSSSFLTTLKPRL    491 - 560
KTEPEEVSIEDSAQSDLKEVMVLNATESFVYEPKEQKKMFHATVATENEVFRVKVFNIDLKEKFTPKKII    561 - 630
AIANYVCRNGFLEVYPFTLVADVNADRNMEIPKGLIRSASVTPKINQLCSQTKGSFVNGVFEVHKKNVRG    631 - 700
EFTYYEIQDNTGKMEVVVHGRLTTINCEEGDKLKLTCFELAPKSGNTGELRSVIHSHIKVIKTRKNKKDI    701 - 770
LNPDSSMETSPDFFF                                                           771 - 785
//

Text Mined References (122)

PMID Year Title
26468536 2015 Dynamic Response of IFI16 and Promyelocytic Leukemia Nuclear Body Components to Herpes Simplex Virus 1 Infection.
26316393 2016 Circulating Interferon-Inducible Protein IFI16 Correlates With Clinical and Serological Features in Rheumatoid Arthritis.
26313692 2015 Strong Upregulation of AIM2 and IFI16 Inflammasomes in the Mucosa of Patients with Active Inflammatory Bowel Disease.
26271464 2015 Interferon gamma-inducible protein 16 in primary Sjögren's syndrome: a novel player in disease pathogenesis?
26185770 2015 IFI16 Expression Is Related to Selected Transcription Factors during B-Cell Differentiation.
26134128 2015 Herpesvirus Genome Recognition Induced Acetylation of Nuclear IFI16 Is Essential for Its Cytoplasmic Translocation, Inflammasome and IFN-? Responses.
26121674 2015 BRCA1 Regulates IFI16 Mediated Nuclear Innate Sensing of Herpes Viral DNA and Subsequent Induction of the Innate Inflammasome and Interferon-? Responses.
26037655 2016 Association of Antibodies to Interferon-Inducible Protein-16 With Markers of More Severe Disease in Primary Sjögren's Syndrome.
26002845 2015 IFI16 mediates soluble Flt-1 and endoglin production by trophoblast cells.
25972554 2015 The Nuclear DNA Sensor IFI16 Acts as a Restriction Factor for Human Papillomavirus Replication through Epigenetic Modifications of the Viral Promoters.
More...