Property Summary

NCBI Gene PubMed Count 2,554
PubMed Score 3234.04
PubTator Score 5115.75

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (5)

Expression

  Differential Expression (19)

Disease log2 FC p
glioblastoma 1.400 5.0e-03
acute quadriplegic myopathy 1.570 9.2e-05
Amyotrophic lateral sclerosis 1.063 1.0e-04
astrocytic glioma 1.200 2.5e-02
autosomal dominant Emery-Dreifuss muscul... 1.490 5.6e-03
breast carcinoma 1.500 6.5e-04
chronic lymphosyte leukemia -1.800 1.6e-04
dermatomyositis 1.600 2.0e-03
diabetes mellitus -1.600 4.6e-02
Duchenne muscular dystrophy 1.570 3.1e-06
ductal carcinoma in situ 1.100 7.7e-04
gastric carcinoma 1.200 1.4e-02
juvenile dermatomyositis 1.970 1.3e-11
oligodendroglioma 1.400 3.7e-02
osteosarcoma 1.656 1.9e-05
pancreatic cancer 1.500 3.3e-03
primary pancreatic ductal adenocarcinoma 1.498 7.7e-03
psoriasis 1.100 3.6e-49
ulcerative colitis 1.400 2.1e-10

 GWAS Trait (1)

Protein-protein Interaction (11)

Gene RIF (2485)

AA Sequence

MEGAGGANDKKKISSERRKEKSRDAARSRRSKESEVFYELAHQLPLPHNVSSHLDKASVMRLTISYLRVR      1 - 70
KLLDAGDLDIEDDMKAQMNCFYLKALDGFVMVLTDDGDMIYISDNVNKYMGLTQFELTGHSVFDFTHPCD     71 - 140
HEEMREMLTHRNGLVKKGKEQNTQRSFFLRMKCTLTSRGRTMNIKSATWKVLHCTGHIHVYDTNSNQPQC    141 - 210
GYKKPPMTCLVLICEPIPHPSNIEIPLDSKTFLSRHSLDMKFSYCDERITELMGYEPEELLGRSIYEYYH    211 - 280
ALDSDHLTKTHHDMFTKGQVTTGQYRMLAKRGGYVWVETQATVIYNTKNSQPQCIVCVNYVVSGIIQHDL    281 - 350
IFSLQQTECVLKPVESSDMKMTQLFTKVESEDTSSLFDKLKKEPDALTLLAPAAGDTIISLDFGSNDTET    351 - 420
DDQQLEEVPLYNDVMLPSPNEKLQNINLAMSPLPTAETPKPLRSSADPALNQEVALKLEPNPESLELSFT    421 - 490
MPQIQDQTPSPSDGSTRQSSPEPNSPSEYCFYVDSDMVNEFKLELVEKLFAEDTEAKNPFSTQDTDLDLE    491 - 560
MLAPYIPMDDDFQLRSFDQLSPLESSSASPESASPQSTVTVFQQTQIQEPTANATTTTATTDELKTVTKD    561 - 630
RMEDIKILIASPSPTHIHKETTSATSSPYRDTQSRTASPNRAGKGVIEQTEKSHPRSPNVLSVALSQRTT    631 - 700
VPEEELNPKILALQNAQRKRKMEHDGSLFQAVGIGTLLQQPDDHAATTSLSWKRVKGCKSSEQNGMEQKT    701 - 770
IILIPSDLACRLLGQSMDESGLPQLTSYDCEVNAPIQGSRNLLQGEELLRALDQVN                  771 - 826
//

Text Mined References (2565)

PMID Year Title