Property Summary

NCBI Gene PubMed Count 2,259
Grant Count 1,231
R01 Count 706
Funding $121,067,161.27
PubMed Score 3140.39
PubTator Score 5115.75

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (19)

Synonym

Accession Q16665 C0LZJ3 Q53XP6 Q96PT9 Q9UPB1 HIF-1-alpha
Symbols HIF1
MOP1
PASD8
HIF-1A
bHLHe78
HIF-1alpha
HIF1-ALPHA
HIF-1-alpha

Gene

PDB

1LM8   1LQB   4AJY   1H2K   1H2L   1H2M   2ILM   1D7G   4H6J   1L3E   3HQR   3HQU   5L9B   5L9V   5LA9   5LAS   1L8C  

MLP Assay (1)

AID Type Active / Inconclusive / Inactive Description
651589 screening 1262 / 0 / 497 Single concentration confirmation of HIF-2a Inhibitors in a HIF-1a counterscreen in human MiAPaCa-2 Cells luciferase reporter assay

Gene RIF (2202)

PMID Text
27125138 High HIF1alpha expression in low glucose condition with improved anaerobic glycolysis seems to be one of the key factors in maintaining the quiescent state of CD34+ stem cells.
27001172 HIF-dependent regulation of ITGA6 is one mechanism by which sorting for CD49f (+) cells enhances cancer stem cells.
26884855 14-3-3zeta regulates HIF-1alpha production in hepatocellular carcinoma cells by directly binding to HIF-1alpha and via PI3K/Akt/NF-small ka, CyrillicB signal transduction pathway.
26882120 ENO1 was demonstrated to be up-regulated by HIF-1alpha in retinal pigment epithelial cells in response to hypoxia, without influencing VEGF secretion.
26856989 Results provided evidence for LRG1 function as a novel inducer of epithelial-mesenchymal transition and angiogenesis in colorectal cancer, which was at least partially through promotion of HIF-1alpha expression.
26846782 High HIF-1alpha expression is associated with papillary thyroid carcinoma.
26828991 Serum concentrations of HIF-1alpha (t=25.53, P<0.05) and VEGF (t=12.10, P<0.05) in early stage group were significantly higher than those in normal group.
26826385 High P-PKCalpha expression in neoplastic gastric cancer biopsy samples as compared to nonneoplastic samples suggests that P-PKCalpha might act as an indicator of gastric cancer progression.
26825709 Inactivation of HIF-1alpha impairs chemotaxis and cell adhesion to stroma, reduces bone marrow and spleen colonization, regulates cell interaction with tumor microenvironment.
26808575 Under hypoxic conditions, SIRT2 inhibition increased the ubiquitination of HIF-1alpha in a VHL-dependent manner, leading to the degradation of HIF-1alpha via a proteasomal pathway.
More...

AA Sequence

MEGAGGANDKKKISSERRKEKSRDAARSRRSKESEVFYELAHQLPLPHNVSSHLDKASVMRLTISYLRVR      1 - 70
KLLDAGDLDIEDDMKAQMNCFYLKALDGFVMVLTDDGDMIYISDNVNKYMGLTQFELTGHSVFDFTHPCD     71 - 140
HEEMREMLTHRNGLVKKGKEQNTQRSFFLRMKCTLTSRGRTMNIKSATWKVLHCTGHIHVYDTNSNQPQC    141 - 210
GYKKPPMTCLVLICEPIPHPSNIEIPLDSKTFLSRHSLDMKFSYCDERITELMGYEPEELLGRSIYEYYH    211 - 280
ALDSDHLTKTHHDMFTKGQVTTGQYRMLAKRGGYVWVETQATVIYNTKNSQPQCIVCVNYVVSGIIQHDL    281 - 350
IFSLQQTECVLKPVESSDMKMTQLFTKVESEDTSSLFDKLKKEPDALTLLAPAAGDTIISLDFGSNDTET    351 - 420
DDQQLEEVPLYNDVMLPSPNEKLQNINLAMSPLPTAETPKPLRSSADPALNQEVALKLEPNPESLELSFT    421 - 490
MPQIQDQTPSPSDGSTRQSSPEPNSPSEYCFYVDSDMVNEFKLELVEKLFAEDTEAKNPFSTQDTDLDLE    491 - 560
MLAPYIPMDDDFQLRSFDQLSPLESSSASPESASPQSTVTVFQQTQIQEPTANATTTTATTDELKTVTKD    561 - 630
RMEDIKILIASPSPTHIHKETTSATSSPYRDTQSRTASPNRAGKGVIEQTEKSHPRSPNVLSVALSQRTT    631 - 700
VPEEELNPKILALQNAQRKRKMEHDGSLFQAVGIGTLLQQPDDHAATTSLSWKRVKGCKSSEQNGMEQKT    701 - 770
IILIPSDLACRLLGQSMDESGLPQLTSYDCEVNAPIQGSRNLLQGEELLRALDQVN                  771 - 826
//

Text Mined References (2270)

PMID Year Title
27125138 2015 Anaerobic Glycolysis and HIF1? Expression in Haematopoietic Stem Cells Explains Its Quiescence Nature.
27001172 2016 ITGA6 is directly regulated by hypoxia-inducible factors and enriches for cancer stem cell activity and invasion in metastatic breast cancer models.
26972000 2016 Substrate-Trapped Interactors of PHD3 and FIH Cluster in Distinct Signaling Pathways.
26884855 2015 14-3-3? up-regulates hypoxia-inducible factor-1? in hepatocellular carcinoma via activation of PI3K/Akt/NF-?B signal transduction pathway.
26882120 2016 Up-Regulation of ENO1 by HIF-1? in Retinal Pigment Epithelial Cells after Hypoxic Challenge Is Not Involved in the Regulation of VEGF Secretion.
26856989 2016 LRG1 modulates epithelial-mesenchymal transition and angiogenesis in colorectal cancer via HIF-1? activation.
26846782 2016 Expression of HIF-1? and HIF-2? correlates to biological and clinical significance in papillary thyroid carcinoma.
26828991 2016 Concentration analysis of hypoxi-inducible factor-1?; and vascular endothelial growth factor in patients with aortic aneurysm at different stages and its clinical significance.
26826385 2016 Cobalt chloride-mediated protein kinase C? (PKC?) phosphorylation induces hypoxia-inducible factor 1? (HIF1?) in the nucleus of gastric cancer cell.
26825709 2016 HIF-1? regulates the interaction of chronic lymphocytic leukemia cells with the tumor microenvironment.
More...