Property Summary

NCBI Gene PubMed Count 24
PubMed Score 23.33
PubTator Score 90.57

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count Z-score Confidence
Kidney Failure, Chronic 46 0.0 0.0
Nephrotic Syndrome 78 0.0 0.0
Disease Target Count P-value
active Crohn's disease 922 1.2e-03
diabetes mellitus 1728 1.4e-03
active ulcerative colitis 764 2.7e-02
gastric carcinoma 807 3.0e-02

Expression

  Differential Expression (4)

Disease log2 FC p
active Crohn's disease -3.129 1.2e-03
active ulcerative colitis -2.165 2.7e-02
diabetes mellitus 1.100 1.4e-03
gastric carcinoma -1.200 3.0e-02

Gene RIF (7)

AA Sequence

MGCRAASGLLPGVAVVLLLLLQSTQSVYIQYQGFRVQLESMKKLSDLEAQWAPSPRLQAQSLLPAVCHHP      1 - 70
ALPQDLQPVCASQEASSIFKTLRTIANDDCELCVNVACTGCL                                 71 - 112
//

Text Mined References (24)

PMID Year Title