Property Summary

NCBI Gene PubMed Count 21
Grant Count 2
Funding $134,547.33
PubMed Score 20.20
PubTator Score 90.57

Knowledge Summary

Patent

No data available

Gene RIF (4)

PMID Text
18037771 Observational study of gene-disease association. (HuGE Navigator)
18037771 The occurrences of the C-A haplotype (rs883062-rs1047047) and the C-A-G haplotype (rs883062-rs1047047-rs2297566) were significantly higher in the essential hypertension group than in the controls.
17582287 Observational study of gene-disease association. (HuGE Navigator)
15780094 Uroguanylin concentrations are increased in patients with chronic renal failure, nephrotic syndrome, or those on dialysis.

AA Sequence

MGCRAASGLLPGVAVVLLLLLQSTQSVYIQYQGFRVQLESMKKLSDLEAQWAPSPRLQAQSLLPAVCHHP      1 - 70
ALPQDLQPVCASQEASSIFKTLRTIANDDCELCVNVACTGCL                                 71 - 112
//

Text Mined References (21)

PMID Year Title
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
22877138 2012 The uroguanylin system and human disease.
18037771 2007 Haplotype-based case-control study of the association between the guanylate cyclase activator 2B (GUCA2B, Uroguanylin) gene and essential hypertension.
17582287 2007 [Association between uroguanylin G-247A polymorphism and blood pressure/fluid and electrolytes homeostasis].
15780094 2005 Guanylin and uroguanylin regulate electrolyte transport in isolated human cortical collecting ducts.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12548407 2003 Occurrence and localization of uroguanylin in the aging human prostate.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11889121 2002 Guanylin, uroguanylin, and heat-stable euterotoxin activate guanylate cyclase C and/or a pertussis toxin-sensitive G protein in human proximal tubule cells.
More...