Property Summary

NCBI Gene PubMed Count 28
Grant Count 15
R01 Count 7
Funding $398,189.88
PubMed Score 37.50
PubTator Score 20.39

Knowledge Summary

Patent (5,330)

Expression

  Differential Expression (8)

Disease log2 FC p
Multiple myeloma 1.311 0.021
psoriasis 1.500 0.000
osteosarcoma 1.343 0.005
astrocytoma -1.400 0.002
tuberculosis -1.100 0.008
intraductal papillary-mucinous carcinoma... 1.300 0.003
intraductal papillary-mucinous neoplasm ... 2.100 0.002
lung cancer 1.100 0.000

MLP Assay (1)

AID Type Active / Inconclusive / Inactive Description
1982 other 0 / 0 / 0 Kinase inhibition selectivity assay for compound SID-48409448

Gene RIF (10)

PMID Text
25340781 MAPK6 could rescue the cell growth induced by miR499a and HBV
24585635 ERK3 regulates endothelial cell migration, proliferation and tube formation by upregulating SRC-3/SP-1-mediated VEGFR2 expression.
22505454 A previously unknown role for ERK3 in promoting lung cancer cell invasiveness by phosphorylating SRC-3 and regulating SRC-3 proinvasive activity by site-specific phosphorylation.
21317288 identify the Erk3 protein as a novel class I Pak substrate and further suggest a role for Pak kinase activity in atypical MAPK signaling.
18235225 Cdc14A forms a stable complex with atypical mitogen-activated protein kinase Erk3 in human cells independent of its intrinsic phosphatase activity but mediated by its regulatory C-terminal domain.
16964379 Extracellular signal-regulated kinase-3 (ERK3/MAPK6) is highly expressed in response to BRAF signaling.
16360641 These findings further expand distinct roles of cyclin D3 and suggest the potential activity of ERK3 in cell proliferation.
15226418 Data show that extracellular signal-regulated kinase 3 (ERK3) is conjugated to ubiquitin via its free NH(2) terminus, and that N-terminal tags stabilize expression of p21 but not that of substrates ubiquitinated on internal lysine residues.
12808096 ERK3 biological activity is regulated by its cellular abundance through the control of protein stability
12239168 HIV-1 gp120 binding to CD4 results in activation of the mitogen-activated protein kinase (MAPK) in CD4(+) lymphocytes prestimulated through their T-cell receptor (TCR)

AA Sequence

MAEKFESLMNIHGFDLGSRYMDLKPLGCGGNGLVFSAVDNDCDKRVAIKKIVLTDPQSVKHALREIKIIR      1 - 70
RLDHDNIVKVFEILGPSGSQLTDDVGSLTELNSVYIVQEYMETDLANVLEQGPLLEEHARLFMYQLLRGL     71 - 140
KYIHSANVLHRDLKPANLFINTEDLVLKIGDFGLARIMDPHYSHKGHLSEGLVTKWYRSPRLLLSPNNYT    141 - 210
KAIDMWAAGCIFAEMLTGKTLFAGAHELEQMQLILESIPVVHEEDRQELLSVIPVYIRNDMTEPHKPLTQ    211 - 280
LLPGISREALDFLEQILTFSPMDRLTAEEALSHPYMSIYSFPMDEPISSHPFHIEDEVDDILLMDETHSH    281 - 350
IYNWERYHDCQFSEHDWPVHNNFDIDEVQLDPRALSDVTDEEEVQVDPRKYLDGDREKYLEDPAFDTNYS    351 - 420
TEPCWQYSDHHENKYCDLECSHTCNYKTRSSSYLDNLVWRESEVNHYYEPKLIIDLSNWKEQSKEKSDKK    421 - 490
GKSKCERNGLVKAQIALEEASQQLAGKEREKNQGFDFDSFIAGTIQLSSQHEPTDVVDKLNDLNSSVSQL    491 - 560
ELKSLISKSVSQEKQEKGMANLAQLEALYQSSWDSQFVSGGEDCFFINQFCEVRKDEQVEKENTYTSYLD    561 - 630
KFFSRKEDTEMLETEPVEDGKLGERGHEEGFLNNSGEFLFNKQLESIGIPQFHSPVGSPLKSIQATLTPS    631 - 700
AMKSSPQIPHQTYSSILKHLN                                                     701 - 721
//

Text Mined References (38)

PMID Year Title
26972000 2016 Substrate-Trapped Interactors of PHD3 and FIH Cluster in Distinct Signaling Pathways.
25416956 2014 A proteome-scale map of the human interactome network.
25340781 2014 Up-regulated microRNA499a by hepatitis B virus induced hepatocellular carcinogenesis via targeting MAPK6.
24585635 2014 ERK3 promotes endothelial cell functions by upregulating SRC-3/SP1-mediated VEGFR2 expression.
23602568 2013 The protein interaction landscape of the human CMGC kinase group.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22645313 2012 Identification and proteomic analysis of distinct UBE3A/E6AP protein complexes.
22505454 2012 ERK3 signals through SRC-3 coactivator to promote human lung cancer cell invasion.
22190034 2011 Global landscape of HIV-human protein complexes.
21988832 2011 Toward an understanding of the protein interaction network of the human liver.
More...