Property Summary

NCBI Gene PubMed Count 162
PubMed Score 783.56
PubTator Score 154.64

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (17)

Disease log2 FC p
adrenocortical carcinoma 1.474 5.5e-03
Atopic dermatitis 1.300 1.1e-03
chronic rhinosinusitis 1.033 1.6e-02
colon cancer 1.200 1.9e-02
cystic fibrosis and chronic rhinosinusit... 1.114 2.2e-02
ependymoma -1.200 1.1e-06
glioblastoma 1.400 8.7e-04
group 3 medulloblastoma 1.200 4.7e-03
interstitial cystitis 1.100 2.7e-04
lung cancer 1.300 2.1e-03
medulloblastoma, large-cell 1.400 9.0e-04
non-small cell lung cancer 2.178 6.0e-18
ovarian cancer 1.300 1.1e-03
pancreatic cancer 1.100 7.1e-04
pediatric high grade glioma 1.500 3.6e-04
psoriasis 1.100 4.9e-05
ulcerative colitis 1.400 1.8e-03

Protein-protein Interaction (1)

Gene RIF (128)

AA Sequence

MTANGTAEAVQIQFGLINCGNKYLTAEAFGFKVNASASSLKKKQIWTLEQPPDEAGSAAVCLRSHLGRYL      1 - 70
AADKDGNVTCEREVPGPDCRFLIVAHDDGRWSLQSEAHRRYFGGTEDRLSCFAQTVSPAEKWSVHIAMHP     71 - 140
QVNIYSVTRKRYAHLSARPADEIAVDRDVPWGVDSLITLAFQDQRYSVQTADHRFLRHDGRLVARPEPAT    141 - 210
GYTLEFRSGKVAFRDCEGRYLAPSGPSGTLKAGKATKVGKDELFALEQSCAQVVLQAANERNVSTRQGMD    211 - 280
LSANQDEETDQETFQLEIDRDTKKCAFRTHTGKYWTLTATGGVQSTASSKNASCYFDIEWRDRRITLRAS    281 - 350
NGKFVTSKKNGQLAASVETAGDSELFLMKLINRPIIVFRGEHGFIGCRKVTGTLDANRSSYDVFQLEFND    351 - 420
GAYNIKDSTGKYWTVGSDSAVTSSGDTPVDFFFEFCDYNKVAIKVGGRYLKGDHAGVLKASAETVDPASL    421 - 490
WEY                                                                       491 - 493
//

Text Mined References (171)

PMID Year Title