Property Summary

NCBI Gene PubMed Count 144
Grant Count 144
R01 Count 78
Funding $18,780,836.48
PubMed Score 741.27
PubTator Score 154.64

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (17)

Disease log2 FC p
psoriasis -1.300 0.000
posterior fossa group B ependymoma -1.600 0.000
group 4 medulloblastoma 2.200 0.000
glioblastoma 1.400 0.001
medulloblastoma, large-cell 2.200 0.000
Atopic dermatitis 1.300 0.001
adrenocortical carcinoma 1.474 0.005
non-small cell lung cancer 2.178 0.000
lung cancer 1.800 0.000
colon cancer 1.700 0.000
pancreatic cancer 1.600 0.000
interstitial cystitis 1.100 0.000
pediatric high grade glioma 1.500 0.000
ulcerative colitis 1.400 0.002
ovarian cancer 1.300 0.001
chronic rhinosinusitis 1.033 0.016
cystic fibrosis and chronic rhinosinusit... 1.114 0.022

Synonym

Accession Q16658 A6NI89 B2RE97 Q96IC5 Q96IH1 Q9BRF1
Symbols HSN
SNL
p55
FAN1

Gene

PDB

1DFC   3LLP   3P53   4GOV   4GOY   4GP0   4GP3  

Gene RIF (110)

PMID Text
26945069 elevated L-plastin expression promotes elongation and reduces protrusion density in cells with relatively lower L-plastin than fascin levels.
26749573 TGF-beta1 could induce the expressions of Fascin1 mRNA and protein and thus improve the invasive and metastatic ability of human renal carcinoma cells.
26647829 The present study revealed an antioncogenic role of miR145 in gastric carcinoma via inhibition of FSCN1, and suggested that miR145 may be used for the treatment of gastric carcinoma.
26522130 Study demonstrates that FSCN1 is associated with increased risk of recurrence in pituitary adenomas and invasion, partially through modifying the expression of Notch/DLL pathway.
26503504 MiR-24 functions as a tumor suppressor in nasopharyngeal carcinoma through targeting FSCN1
26362828 Strong fascin-1 expression was found in 14.3% of borderline epithelial tumors of the ovary and linked to features related to elevated risk of recurrence.
26349603 Fascin-1 and paxillin were expressed in 58% and 43% of infiltrating duct carcinoma cases. There was a significant correlation between fascin-1 and paxillin expression and tumor grade, clinical stage, lymph-node metastasis grade, and HER2 expression.
26238532 miR-145 negatively regulates the protein expression of its target FSCN1 in the NSCLC cell line H129.
26211585 FSCN1 plays an important role in non-small cell lung cancer progression and prognosis.
26173501 The up-regulation of FSCN1 is a prognostic factor in patients diagnosed with hepatocellular liver cancer.
More...

AA Sequence

MTANGTAEAVQIQFGLINCGNKYLTAEAFGFKVNASASSLKKKQIWTLEQPPDEAGSAAVCLRSHLGRYL      1 - 70
AADKDGNVTCEREVPGPDCRFLIVAHDDGRWSLQSEAHRRYFGGTEDRLSCFAQTVSPAEKWSVHIAMHP     71 - 140
QVNIYSVTRKRYAHLSARPADEIAVDRDVPWGVDSLITLAFQDQRYSVQTADHRFLRHDGRLVARPEPAT    141 - 210
GYTLEFRSGKVAFRDCEGRYLAPSGPSGTLKAGKATKVGKDELFALEQSCAQVVLQAANERNVSTRQGMD    211 - 280
LSANQDEETDQETFQLEIDRDTKKCAFRTHTGKYWTLTATGGVQSTASSKNASCYFDIEWRDRRITLRAS    281 - 350
NGKFVTSKKNGQLAASVETAGDSELFLMKLINRPIIVFRGEHGFIGCRKVTGTLDANRSSYDVFQLEFND    351 - 420
GAYNIKDSTGKYWTVGSDSAVTSSGDTPVDFFFEFCDYNKVAIKVGGRYLKGDHAGVLKASAETVDPASL    421 - 490
WEY                                                                       491 - 493
//

Text Mined References (153)

PMID Year Title
26945069 2016 Fascin Rigidity and L-plastin Flexibility Cooperate in Cancer Cell Invadopodia and Filopodia.
26749573 2016 TGF-?1-induced Fascin1 promotes cell invasion and metastasis of human 786-0 renal carcinoma cells.
26647829 2016 MicroRNA?145 inhibits the malignant phenotypes of gastric carcinoma cells via downregulation of fascin 1 expression.
26522130 2016 The role of FSCN1 in migration and invasion of pituitary adenomas.
26503504 2015 MiR-24 functions as a tumor suppressor in nasopharyngeal carcinoma through targeting FSCN1.
26362828 2016 Fascin-1 expression as stratification marker in borderline epithelial tumours of the ovary.
26349603 2015 Cytoskeletal Focal Adhesion Proteins Fascin-1 and Paxillin Are Predictors of Malignant Progression and Poor Prognosis in Human Breast Cancer.
26238532 2015 MicroRNA-145 inhibits migration and invasion via inhibition of fascin 1 protein expression in non-small-cell lung cancer cells.
26211585 2015 The clinical significance of FSCN1 in non-small cell lung cancer.
26173501 2015 MicroRNA-145 and MicroRNA-133a Inhibited Proliferation, Migration, and Invasion, While Promoted Apoptosis in Hepatocellular Carcinoma Cells Via Targeting FSCN1.
More...