Property Summary

NCBI Gene PubMed Count 81
Grant Count 158
R01 Count 104
Funding $11,539,511.23
PubMed Score 256.46
PubTator Score 175.68

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Synonym

Accession Q16656 A8K4C6 B4DDV6 Q15305 Q96AN2 NRF-1
Symbols ALPHA-PAL

Gene

Gene RIF (54)

PMID Text
26492917 EglN2 associates with the NRF1-PGC1alpha complex and controls mitochondrial function in breast cancer
26268886 Importantly, Nrf1 activity is positively and/or negatively regulated by distinct doses of proteasome and calpain inhibitors
26254094 This review outlines Nrf1 structure, function, regulation and its links to insulin resistance, diabetes and inflammation.
26201446 Low NRF1 expression was associated lymphatic metastasis and radio-resistance in nasopharyngeal carcinoma.
25976310 Lack of aprataxin impairs mitochondrial functions via downregulation of the APE1/NRF1/NRF2 pathway.
25965299 Results present evidence in the support of E2-induced ROS-mediated AKT signalling leading to the activation of NRF-1-regulated cell cycle genes.
25959814 We show that composite nucleosomes containing mH2A and NRF-1 are stably positioned on gene regulatory regions and can buffer transcriptional noise associated with antiviral responses
25792330 This study identified a regulatory branch of the mitochondrial unfolded protein response (UPR(mt)), which is mediated by the interplay of SIRT7 and NRF1 and is coupled to cellular energy metabolism and proliferation.
25637874 The results indicate that Nrf1 is a transcriptional activator of Herpud1 expression during ER stress, and they suggest Nrf1 is a key player in the regulation of the ER stress response in cells.
25130429 The treatment with E2, Res, or VC significantly increased mRNA and protein expression levels of Nrf1.
More...

AA Sequence

MEEHGVTQTEHMATIEAHAVAQQVQQVHVATYTEHSMLSADEDSPSSPEDTSYDDSDILNSTAADEVTAH      1 - 70
LAAAGPVGMAAAAAVATGKKRKRPHVFESNPSIRKRQQTRLLRKLRATLDEYTTRVGQQAIVLCISPSKP     71 - 140
NPVFKVFGAAPLENVVRKYKSMILEDLESALAEHAPAPQEVNSELPPLTIDGIPVSVDKMTQAQLRAFIP    141 - 210
EMLKYSTGRGKPGWGKESCKPIWWPEDIPWANVRSDVRTEEQKQRVSWTQALRTIVKNCYKQHGREDLLY    211 - 280
AFEDQQTQTQATATHSIAHLVPSQTVVQTFSNPDGTVSLIQVGTGATVATLADASELPTTVTVAQVNYSA    281 - 350
VADGEVEQNWATLQGGEMTIQTTQASEATQAVASLAEAAVAASQEMQQGATVTMALNSEAAAHAVATLAE    351 - 420
ATLQGGGQIVLSGETAAAVGALTGVQDANGLVQIPVSMYQTVVTSLAQGNGPVQVAMAPVTTRISDSAVT    421 - 490
MDGQAVEVVTLEQ                                                             491 - 503
//

Text Mined References (87)

PMID Year Title
26492917 2015 EglN2 associates with the NRF1-PGC1? complex and controls mitochondrial function in breast cancer.
26268886 2015 The selective post-translational processing of transcription factor Nrf1 yields distinct isoforms that dictate its ability to differentially regulate gene expression.
26254094 2015 Changing gears in Nrf1 research, from mechanisms of regulation to its role in disease and prevention.
26201446 2015 miR-504 mediated down-regulation of nuclear respiratory factor 1 leads to radio-resistance in nasopharyngeal carcinoma.
25976310 2015 Lack of aprataxin impairs mitochondrial functions via downregulation of the APE1/NRF1/NRF2 pathway.
25965299 2015 Redox signalling to nuclear regulatory proteins by reactive oxygen species contributes to oestrogen-induced growth of breast cancer cells.
25959814 2015 Composite macroH2A/NRF-1 Nucleosomes Suppress Noise and Generate Robustness in Gene Expression.
25792330 2015 Stem cell aging. A mitochondrial UPR-mediated metabolic checkpoint regulates hematopoietic stem cell aging.
25637874 2015 Induction of Herpud1 expression by ER stress is regulated by Nrf1.
25416956 2014 A proteome-scale map of the human interactome network.
More...