Property Summary

NCBI Gene PubMed Count 90
PubMed Score 272.99
PubTator Score 175.68

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Disease log2 FC p
astrocytic glioma 1.900 9.1e-03
ependymoma 2.000 1.4e-02
intraductal papillary-mucinous adenoma (... 1.100 7.3e-04
intraductal papillary-mucinous carcinoma... 1.600 5.8e-03
intraductal papillary-mucinous neoplasm ... 1.400 5.9e-03
oligodendroglioma 1.500 1.6e-02
osteosarcoma -2.887 1.1e-09
Pick disease 1.100 1.4e-02
psoriasis -1.900 5.7e-05

Protein-protein Interaction (1)

Gene RIF (62)

AA Sequence

MEEHGVTQTEHMATIEAHAVAQQVQQVHVATYTEHSMLSADEDSPSSPEDTSYDDSDILNSTAADEVTAH      1 - 70
LAAAGPVGMAAAAAVATGKKRKRPHVFESNPSIRKRQQTRLLRKLRATLDEYTTRVGQQAIVLCISPSKP     71 - 140
NPVFKVFGAAPLENVVRKYKSMILEDLESALAEHAPAPQEVNSELPPLTIDGIPVSVDKMTQAQLRAFIP    141 - 210
EMLKYSTGRGKPGWGKESCKPIWWPEDIPWANVRSDVRTEEQKQRVSWTQALRTIVKNCYKQHGREDLLY    211 - 280
AFEDQQTQTQATATHSIAHLVPSQTVVQTFSNPDGTVSLIQVGTGATVATLADASELPTTVTVAQVNYSA    281 - 350
VADGEVEQNWATLQGGEMTIQTTQASEATQAVASLAEAAVAASQEMQQGATVTMALNSEAAAHAVATLAE    351 - 420
ATLQGGGQIVLSGETAAAVGALTGVQDANGLVQIPVSMYQTVVTSLAQGNGPVQVAMAPVTTRISDSAVT    421 - 490
MDGQAVEVVTLEQ                                                             491 - 503
//

Text Mined References (97)

PMID Year Title