Property Summary

NCBI Gene PubMed Count 50
PubMed Score 44.52
PubTator Score 92.11

Knowledge Summary

Patent (6,091)

TINX Plot

  Disease Sources (3)

Disease Target Count P-value
lung adenocarcinoma 2714 2.68533115608746E-29
non-small cell lung cancer 2798 1.52461166974867E-20
psoriasis 6685 1.24137474593369E-11
Breast cancer 3099 2.87881033691022E-10
ovarian cancer 8492 6.66658555510756E-7
pituitary cancer 1972 2.075873360136E-6
colon cancer 1475 3.01020288709768E-6
medulloblastoma, large-cell 6234 3.57469217275236E-6
juvenile dermatomyositis 1189 8.78909801499643E-6
lung cancer 4473 2.19976700041845E-5
group 4 medulloblastoma 1875 2.22479155922685E-5
ependymoma 2514 8.77301556437068E-5
atypical teratoid/rhabdoid tumor 1095 1.01029075770921E-4
ulcerative colitis 2087 1.43741259243904E-4
intraductal papillary-mucinous adenoma (IPMA) 2956 2.52731269666976E-4
breast carcinoma 1614 2.96711358084294E-4
gastric cancer 436 4.43595879400871E-4
intraductal papillary-mucinous neoplasm (IPMN) 3289 6.56828011488757E-4
intraductal papillary-mucinous carcinoma (IPMC) 2988 9.64513155135996E-4
ductal carcinoma in situ 1745 0.00131765489451957
fibroadenoma 557 0.00133538026366642
primary pancreatic ductal adenocarcinoma 1271 0.0017784959416061
pancreatic cancer 2300 0.00218501600073603
pediatric high grade glioma 2712 0.00223689043741078
Down syndrome 548 0.00325741525360608
tuberculosis and treatment for 6 months 686 0.00454346765746289
invasive ductal carcinoma 2950 0.00595673219483786
active Crohn's disease 918 0.00846004091401588
autosomal dominant Emery-Dreifuss muscular dystrophy 499 0.0116252979794508
glioblastoma 5572 0.0116726423828783
pancreatic carcinoma 567 0.0227934357932978
acute quadriplegic myopathy 1157 0.0271067322144602
chronic rhinosinusitis 512 0.0273902331449481
osteosarcoma 7933 0.0325515615568077
mucosa-associated lymphoid tissue lymphoma 480 0.0328094420105837
Atopic dermatitis 944 0.0366473424884273
Endometriosis 535 0.0372671837530439
cystic fibrosis and chronic rhinosinusitis 213 0.0416490406386867
Disease Target Count Z-score Confidence
Obesity 616 3.414 1.7

Expression

Synonym

Accession Q16654
Symbols

Gene

PANTHER Protein Class (3)

PDB

2E0A   2ZDX   2ZDY   2ZKJ   3D2R  

  Ortholog (12)

Gene RIF (31)

PMID Text
27456910 Combined speed endurance and endurance exercise amplify the exercise-induced PGC-1alpha and PDK4 mRNA response in trained human muscle.
26560812 upregulation of PDK4 promotes vascular calcification by increasing osteogenic markers with no adverse effect on bone formation, demonstrating that PDK4 is a therapeutic target for vascular calcification.
26506419 High PDK4 expression is associated with hepatocellular cancer.
26469385 HIV-1 MA increases PDK4 mRNA expression in HepG2 cells
25794976 Swiss PDB Viewer identifies NFkappaB subunit p100/p49 as a potential interacting partner for PDK4. Relationship between PDK4 and apoptosis is suggested.
25609694 ZBTB2 may increase cell proliferation by reprogramming glucose metabolic pathways to favor glycolysis by upregulating PDK4 expression via repression of RelA/p65 expression
25311062 Fatty acids induce the expression of PDK4 mRNA, which was increased in myotubes cultured from obese and T2DM donors.
25164809 PDK4 promotes tumorigenesis through activation of the CREB-RHEB-mTORC1 signaling cascade.
24837562 Methylation increased in PDK4, IL1 B, IL6, and TNF promoters 12 months after gastric bypass.
23842279 HIV-1 MA increases PDK4 mRNA expression in HepG2 cells
More...

AA Sequence

MKAARFVLRSAGSLNGAGLVPREVEHFSRYSPSPLSMKQLLDFGSENACERTSFAFLRQELPVRLANILK      1 - 70
EIDILPTQLVNTSSVQLVKSWYIQSLMDLVEFHEKSPDDQKALSDFVDTLIKVRNRHHNVVPTMAQGIIE     71 - 140
YKDACTVDPVTNQNLQYFLDRFYMNRISTRMLMNQHILIFSDSQTGNPSHIGSIDPNCDVVAVVQDAFEC    141 - 210
SRMLCDQYYLSSPELKLTQVNGKFPDQPIHIVYVPSHLHHMLFELFKNAMRATVEHQENQPSLTPIEVIV    211 - 280
VLGKEDLTIKISDRGGGVPLRIIDRLFSYTYSTAPTPVMDNSRNAPLAGFGYGLPISRLYAKYFQGDLNL    281 - 350
YSLSGYGTDAIIYLKALSSESIEKLPVFNKSAFKHYQMSSEADDWCIPSREPKNLAKEVAM             351 - 411
//

Text Mined References (52)

PMID Year Title
27456910 2016 Combined speed endurance and endurance exercise amplify the exercise-induced PGC-1? and PDK4 mRNA response in trained human muscle.
26560812 2015 Pyruvate Dehydrogenase Kinase 4 Promotes Vascular Calcification via SMAD1/5/8 Phosphorylation.
26506419 2015 Active glycolytic metabolism in CD133(+) hepatocellular cancer stem cells: regulation by MIR-122.
25794976 2015 Pyruvate dehydrogenase kinase 4 (PDK4) could be involved in a regulatory role in apoptosis and a link between apoptosis and insulin resistance.
25609694 2015 ZBTB2 increases PDK4 expression by transcriptional repression of RelA/p65.
25311062 2015 Increased pyruvate dehydrogenase kinase expression in cultured myotubes from obese and diabetic individuals.
25164809 2014 PDK4 protein promotes tumorigenesis through activation of cAMP-response element-binding protein (CREB)-Ras homolog enriched in brain (RHEB)-mTORC1 signaling cascade.
24837562 Altered promoter methylation of PDK4, IL1 B, IL6, and TNF after Roux-en Y gastric bypass.
23050013 2012 Hypoxia induces PDK4 gene expression through induction of the orphan nuclear receptor ERR?.
22020285 2011 Image-based genome-wide siRNA screen identifies selective autophagy factors.
More...