Property Summary

NCBI Gene PubMed Count 58
PubMed Score 50.54
PubTator Score 92.11

Knowledge Summary

Patent (6,091)

TINX Plot

  Disease (4)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.7
Disease Target Count Z-score Confidence
Obesity 678 3.419 1.7

Expression

  Differential Expression (38)

Disease log2 FC p
active Crohn's disease -1.755 8.5e-03
active ulcerative colitis -1.355 1.8e-02
acute quadriplegic myopathy 1.961 2.7e-02
adult high grade glioma -1.600 5.8e-03
Atopic dermatitis -1.500 3.7e-02
atypical teratoid / rhabdoid tumor -1.900 1.1e-02
autosomal dominant Emery-Dreifuss muscul... 2.384 1.2e-02
Breast cancer -2.800 3.4e-02
breast carcinoma -2.400 3.0e-04
chronic rhinosinusitis -1.255 3.5e-02
colon cancer -1.600 1.3e-02
cystic fibrosis -1.100 3.7e-03
Down syndrome 1.200 3.3e-03
ductal carcinoma in situ -2.500 1.9e-02
Endometriosis -1.582 2.2e-02
ependymoma -1.400 8.8e-05
fibroadenoma -1.100 3.9e-02
gastric cancer 1.600 4.4e-04
glioblastoma -1.400 1.9e-03
group 3 medulloblastoma -2.300 7.0e-05
intraductal papillary-mucinous adenoma (... -2.300 2.6e-03
intraductal papillary-mucinous carcinoma... -2.500 2.8e-03
intraductal papillary-mucinous neoplasm ... -2.800 1.1e-02
invasive ductal carcinoma -3.700 6.0e-03
juvenile dermatomyositis 1.336 8.9e-03
lung adenocarcinoma -1.900 9.0e-11
lung cancer -2.100 2.2e-05
medulloblastoma, large-cell -3.500 3.6e-06
mucosa-associated lymphoid tissue lympho... 3.123 3.3e-02
non-small cell lung cancer -1.103 2.6e-09
osteosarcoma -1.584 1.8e-02
ovarian cancer -3.800 6.7e-07
pancreatic cancer 1.500 2.3e-02
pancreatic carcinoma 1.500 2.3e-02
pancreatic ductal adenocarcinoma liver m... -2.712 1.2e-02
pituitary cancer -1.700 7.4e-04
psoriasis -1.400 4.8e-12
tuberculosis and treatment for 6 months 2.000 4.5e-03

Protein-protein Interaction (4)

Gene RIF (39)

AA Sequence

MKAARFVLRSAGSLNGAGLVPREVEHFSRYSPSPLSMKQLLDFGSENACERTSFAFLRQELPVRLANILK      1 - 70
EIDILPTQLVNTSSVQLVKSWYIQSLMDLVEFHEKSPDDQKALSDFVDTLIKVRNRHHNVVPTMAQGIIE     71 - 140
YKDACTVDPVTNQNLQYFLDRFYMNRISTRMLMNQHILIFSDSQTGNPSHIGSIDPNCDVVAVVQDAFEC    141 - 210
SRMLCDQYYLSSPELKLTQVNGKFPDQPIHIVYVPSHLHHMLFELFKNAMRATVEHQENQPSLTPIEVIV    211 - 280
VLGKEDLTIKISDRGGGVPLRIIDRLFSYTYSTAPTPVMDNSRNAPLAGFGYGLPISRLYAKYFQGDLNL    281 - 350
YSLSGYGTDAIIYLKALSSESIEKLPVFNKSAFKHYQMSSEADDWCIPSREPKNLAKEVAM             351 - 411
//

Text Mined References (60)

PMID Year Title