Property Summary

NCBI Gene PubMed Count 50
Grant Count 56
R01 Count 32
Funding $3,732,037.03
PubMed Score 44.52
PubTator Score 92.11

Knowledge Summary

Patent (6,091)

Expression

Synonym

Accession Q16654
Symbols

Gene

PANTHER Protein Class (3)

PDB

2E0A   2ZDX   2ZDY   2ZKJ   3D2R  

Gene RIF (32)

PMID Text
27456910 Combined speed endurance and endurance exercise amplify the exercise-induced PGC-1alpha and PDK4 mRNA response in trained human muscle.
26560812 upregulation of PDK4 promotes vascular calcification by increasing osteogenic markers with no adverse effect on bone formation, demonstrating that PDK4 is a therapeutic target for vascular calcification.
26506419 High PDK4 expression is associated with hepatocellular cancer.
26469385 HIV-1 MA increases PDK4 mRNA expression in HepG2 cells
25794976 Swiss PDB Viewer identifies NFkappaB subunit p100/p49 as a potential interacting partner for PDK4. Relationship between PDK4 and apoptosis is suggested.
25609694 ZBTB2 may increase cell proliferation by reprogramming glucose metabolic pathways to favor glycolysis by upregulating PDK4 expression via repression of RelA/p65 expression
25311062 Fatty acids induce the expression of PDK4 mRNA, which was increased in myotubes cultured from obese and T2DM donors.
25164809 PDK4 promotes tumorigenesis through activation of the CREB-RHEB-mTORC1 signaling cascade.
24837562 Methylation increased in PDK4, IL1 B, IL6, and TNF promoters 12 months after gastric bypass.
23842279 HIV-1 MA increases PDK4 mRNA expression in HepG2 cells
More...

AA Sequence

MKAARFVLRSAGSLNGAGLVPREVEHFSRYSPSPLSMKQLLDFGSENACERTSFAFLRQELPVRLANILK      1 - 70
EIDILPTQLVNTSSVQLVKSWYIQSLMDLVEFHEKSPDDQKALSDFVDTLIKVRNRHHNVVPTMAQGIIE     71 - 140
YKDACTVDPVTNQNLQYFLDRFYMNRISTRMLMNQHILIFSDSQTGNPSHIGSIDPNCDVVAVVQDAFEC    141 - 210
SRMLCDQYYLSSPELKLTQVNGKFPDQPIHIVYVPSHLHHMLFELFKNAMRATVEHQENQPSLTPIEVIV    211 - 280
VLGKEDLTIKISDRGGGVPLRIIDRLFSYTYSTAPTPVMDNSRNAPLAGFGYGLPISRLYAKYFQGDLNL    281 - 350
YSLSGYGTDAIIYLKALSSESIEKLPVFNKSAFKHYQMSSEADDWCIPSREPKNLAKEVAM             351 - 411
//

Text Mined References (52)

PMID Year Title
27456910 2016 Combined speed endurance and endurance exercise amplify the exercise-induced PGC-1? and PDK4 mRNA response in trained human muscle.
26560812 2015 Pyruvate Dehydrogenase Kinase 4 Promotes Vascular Calcification via SMAD1/5/8 Phosphorylation.
26506419 2015 Active glycolytic metabolism in CD133(+) hepatocellular cancer stem cells: regulation by MIR-122.
25794976 2015 Pyruvate dehydrogenase kinase 4 (PDK4) could be involved in a regulatory role in apoptosis and a link between apoptosis and insulin resistance.
25609694 2015 ZBTB2 increases PDK4 expression by transcriptional repression of RelA/p65.
25311062 2015 Increased pyruvate dehydrogenase kinase expression in cultured myotubes from obese and diabetic individuals.
25164809 2014 PDK4 protein promotes tumorigenesis through activation of cAMP-response element-binding protein (CREB)-Ras homolog enriched in brain (RHEB)-mTORC1 signaling cascade.
24837562 Altered promoter methylation of PDK4, IL1 B, IL6, and TNF after Roux-en Y gastric bypass.
23050013 2012 Hypoxia induces PDK4 gene expression through induction of the orphan nuclear receptor ERR?.
22020285 2011 Image-based genome-wide siRNA screen identifies selective autophagy factors.
More...