Property Summary

NCBI Gene PubMed Count 64
Grant Count 353
R01 Count 227
Funding $40,733,091.68
PubMed Score 1159.81
PubTator Score 356.31

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (13)

Disease log2 FC p
ependymoma -3.500 0.000
astrocytoma -1.200 0.000
glioblastoma -2.100 0.021
oligodendroglioma -1.700 0.000
group 3 medulloblastoma -3.800 0.001
atypical teratoid/rhabdoid tumor -3.400 0.000
medulloblastoma, large-cell -3.100 0.006
primitive neuroectodermal tumor -2.600 0.006
pediatric high grade glioma -2.600 0.001
subependymal giant cell astrocytoma -4.125 0.005
Pick disease -1.600 0.041
progressive supranuclear palsy -1.900 0.007
Down syndrome 1.600 0.003

Gene

MOG

PANTHER Protein Class (2)

PDB

1Q70  

Gene RIF (57)

PMID Text
25930075 This study demonstrated that increased expression of mRNA of OLIG1 in ventral prefrontal white matter in major depressive disorder.
25838512 In patients with idiopathic optic neuritis, 27.6% (8/29) were positive for MOG antibodies. Three of the eight MOG-positive patients showed significantly high CSF levels of myelin basic protein. Five had optic pain and three had prodromal infection.
25393803 Immune modulation by a tolerogenic myelin oligodendrocyte glycoprotein (MOG)10-60 containing fusion protein in the marmoset experimental autoimmune encephalomyelitis model.
24935259 These data demonstrate a new role for myelin glycosylation in the control of immune homeostasis in the healthy human brain through the MOG-DC-SIGN homeostatic regulatory axis, which is comprised by inflammatory insults that affect glycosylation.
24415568 Patients with neuromyelitis optica spectrum disorders with MOG antibodies have distinct clinical features, fewer attacks, and better recovery than patients with AQP4 antibodies or patients seronegative for both antibodies.
23032943 Bipolar I disorder and schizophrenia share a number of common genetic risk loci and susceptibility genes including the genes coding for myelin oligodendrocytes glycoprotein (MOG).
22494461 findings suggest that immune reactions toward MOG and in particular MOG-specific antibodies may play a functional role in multiple sclerosis
22204662 We could show for the first time that a subset of aquaporin 4-IgG seronegative patients with neuromyelitis optica exhibit a MOG-IgG mediated immune response
22093619 This study provides valuable information about requirements of anti-myelin oligodendrocyte glycoprotein reactivity for being regarded as a prognostic biomarker in a subtype of MS.
21907016 A missense mutation in myelin oligodendrocyte glycoprotein as a cause of familial narcolepsy with cataplexy.
More...

AA Sequence

MASLSRPSLPSCLCSFLLLLLLQVSSSYAGQFRVIGPRHPIRALVGDEVELPCRISPGKNATGMEVGWYR      1 - 70
PPFSRVVHLYRNGKDQDGDQAPEYRGRTELLKDAIGEGKVTLRIRNVRFSDEGGFTCFFRDHSYQEEAAM     71 - 140
ELKVEDPFYWVSPGVLVLLAVLPVLLLQITVGLIFLCLQYRLRGKLRAEIENLHRTFDPHFLRVPCWKIT    141 - 210
LFVIVPVLGPLVALIICYNWLHRRLAGQFLEELRNPF                                     211 - 247
//

Text Mined References (66)

PMID Year Title
25930075 2015 Oligodendrocyte morphometry and expression of myelin - Related mRNA in ventral prefrontal white matter in major depressive disorder.
25838512 2015 Antibodies to myelin oligodendrocyte glycoprotein in idiopathic optic neuritis.
25393803 2015 Immune modulation by a tolerogenic myelin oligodendrocyte glycoprotein (MOG)10-60 containing fusion protein in the marmoset experimental autoimmune encephalomyelitis model.
24935259 2014 CNS myelin induces regulatory functions of DC-SIGN-expressing, antigen-presenting cells via cognate interaction with MOG.
24415568 2014 Distinction between MOG antibody-positive and AQP4 antibody-positive NMO spectrum disorders.
23284291 2012 Genome-wide joint meta-analysis of SNP and SNP-by-smoking interaction identifies novel loci for pulmonary function.
23032943 2012 The association of white matter volume in psychotic disorders with genotypic variation in NRG1, MOG and CNP: a voxel-based analysis in affected individuals and their unaffected relatives.
22494461 2012 The role of myelin oligodendrocyte glycoprotein in autoimmune demyelination: a target for multiple sclerosis therapy?
22412388 2012 A genome-wide scan of Ashkenazi Jewish Crohn's disease suggests novel susceptibility loci.
22204662 2011 Complement activating antibodies to myelin oligodendrocyte glycoprotein in neuromyelitis optica and related disorders.
More...