Property Summary

NCBI Gene PubMed Count 68
PubMed Score 1239.74
PubTator Score 356.31

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (6)

Expression

  Differential Expression (13)

Disease log2 FC p
adult high grade glioma -2.200 2.7e-02
astrocytoma -1.200 1.9e-04
atypical teratoid / rhabdoid tumor -1.200 2.6e-03
Down syndrome 1.300 1.5e-02
ependymoma -2.800 3.1e-02
glioblastoma -1.100 3.1e-02
group 3 medulloblastoma -2.200 5.2e-03
medulloblastoma, large-cell -3.100 5.8e-03
oligodendroglioma -1.300 5.7e-06
Pick disease -1.500 3.8e-02
primitive neuroectodermal tumor -1.200 2.2e-02
progressive supranuclear palsy -1.700 1.5e-02
subependymal giant cell astrocytoma -3.507 1.9e-03

Gene RIF (61)

AA Sequence

MASLSRPSLPSCLCSFLLLLLLQVSSSYAGQFRVIGPRHPIRALVGDEVELPCRISPGKNATGMEVGWYR      1 - 70
PPFSRVVHLYRNGKDQDGDQAPEYRGRTELLKDAIGEGKVTLRIRNVRFSDEGGFTCFFRDHSYQEEAAM     71 - 140
ELKVEDPFYWVSPGVLVLLAVLPVLLLQITVGLIFLCLQYRLRGKLRAEIENLHRTFDPHFLRVPCWKIT    141 - 210
LFVIVPVLGPLVALIICYNWLHRRLAGQFLEELRNPF                                     211 - 247
//

Text Mined References (70)

PMID Year Title