Property Summary

NCBI Gene PubMed Count 55
Grant Count 49
R01 Count 14
Funding $4,721,736.16
PubMed Score 104.38
PubTator Score 91.10

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Disease log2 FC p
psoriasis 1.200 0.001
breast carcinoma 1.100 0.006
primary Sjogren syndrome -1.100 0.035
lung adenocarcinoma 1.066 0.003
lung carcinoma -2.400 0.000
spina bifida -2.103 0.046
ductal carcinoma in situ 2.800 0.001
invasive ductal carcinoma 3.100 0.005
pituitary cancer -1.100 0.000

Gene RIF (40)

PMID Text
27036110 Overexpression of PRSS8 mRNA and high levels of prostasin in multiple subtypes of early stage ovarian tumors may provide clinical biomarkers for early detection of ovarian cancer.
26867056 It is concluded that prostasin protein level change is less likely to be causally involved in placental dysfunction in preeclampsia.
26252104 Polymorphism of the prostasin gene is closely associated with poor pregnancy outcomes of early-onset severe preeclampsia.
25931204 In urinary exosomes, NCC and prostasin had a diurnal pattern parallel to ADH and aquaporin 2, confirming that, in healthy subjects, both prostasin and NCC relate to water balance.
25188517 Prostasin regulate the Lin28/Let-7 loop in ovarian cancer cells.
24890150 The higher frequency of C allele of prostasin gene at rs12597511 is associated with severe preeclampsia.
24434518 Prostasin repress cancer cells and contribute to chemoresistance by modulating the CASP/PAK2-p34/actin pathway.
23707658 Our study suggested that Axl and prostasin expression may be closely related to carcinogenesis, metastasis, and prognosis of ovarian adenocarcinoma.
23673661 prostasin is a non-enzymatic co-factor for matriptase activation
23443662 Prostasin requires expression of endogenous matriptase to stimulate barrier formation since matriptase depletion by siRNA silencing abrogates prostasin barrier-forming activity.
More...

AA Sequence

MAQKGVLGPGQLGAVAILLYLGLLRSGTGAEGAEAPCGVAPQARITGGSSAVAGQWPWQVSITYEGVHVC      1 - 70
GGSLVSEQWVLSAAHCFPSEHHKEAYEVKLGAHQLDSYSEDAKVSTLKDIIPHPSYLQEGSQGDIALLQL     71 - 140
SRPITFSRYIRPICLPAANASFPNGLHCTVTGWGHVAPSVSLLTPKPLQQLEVPLISRETCNCLYNIDAK    141 - 210
PEEPHFVQEDMVCAGYVEGGKDACQGDSGGPLSCPVEGLWYLTGIVSWGDACGARNRPGVYTLASSYASW    211 - 280
IQSKVTELQPRVVPQTQESQPDSNLCGSHLAFSSAPAQGLLRPILFLPLGLALGLLSPWLSEH           281 - 343
//

Text Mined References (57)

PMID Year Title
27036110 2016 The serine protease prostasin (PRSS8) is a potential biomarker for early detection of ovarian cancer.
26867056 2016 Prostasin and matriptase (ST14) in placenta from preeclamptic and healthy pregnant women.
26317012 2013 Prostasin: An Epithelial Sodium Channel Regulator.
26252104 2015 [Association of prostasin gene rs12597511 polymorphism with outcomes of pregnancy with severe preeclampsia].
25931204 2015 Circadian exosomal expression of renal thiazide-sensitive NaCl cotransporter (NCC) and prostasin in healthy individuals.
25188517 2014 PSP94, an upstream signaling mediator of prostasin found highly elevated in ovarian cancer.
24890150 2014 Prostasin gene polymorphism at rs12597511 is associated with severe preeclampsia in Chinese Han women.
24434518 2014 Prostasin may contribute to chemoresistance, repress cancer cells in ovarian cancer, and is involved in the signaling pathways of CASP/PAK2-p34/actin.
23707658 2013 Axl and prostasin are biomarkers for prognosis of ovarian adenocarcinoma.
23673661 2013 A matriptase-prostasin reciprocal zymogen activation complex with unique features: prostasin as a non-enzymatic co-factor for matriptase activation.
More...