Property Summary

NCBI Gene PubMed Count 9
Grant Count 22
R01 Count 11
Funding $1,633,909.37
PubMed Score 60.56
PubTator Score 36.41

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
astrocytic glioma -1.600 0.001
ependymoma -2.100 0.000
oligodendroglioma -1.600 0.000
glioblastoma multiforme -1.600 0.000
atypical teratoid / rhabdoid tumor -1.500 0.000
medulloblastoma, large-cell 2.500 0.004
pediatric high grade glioma -1.300 0.005
group 4 medulloblastoma 2.900 0.001
pilocytic astrocytoma -1.600 0.001
Pick disease -1.600 0.003

Gene RIF (2)

PMID Text
25232744 TBR1 homodimerizes; it interacts with FOXP2, a transcription factor implicated in speech/language disorders, and this interaction is disrupted by pathogenic mutations affecting either protein
11719470 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MQLEHCLSPSIMLSKKFLNVSSSYPHSGGSELVLHDHPIISTTDNLERSSPLKKITRGMTNQSDTDNFPD      1 - 70
SKDSPGDVQRSKLSPVLDGVSELRHSFDGSAADRYLLSQSSQPQSAATAPSAMFPYPGQHGPAHPAFSIG     71 - 140
SPSRYMAHHPVITNGAYNSLLSNSSPQGYPTAGYPYPQQYGHSYQGAPFYQFSSTQPGLVPGKAQVYLCN    141 - 210
RPLWLKFHRHQTEMIITKQGRRMFPFLSFNISGLDPTAHYNIFVDVILADPNHWRFQGGKWVPCGKADTN    211 - 280
VQGNRVYMHPDSPNTGAHWMRQEISFGKLKLTNNKGASNNNGQMVVLQSLHKYQPRLHVVEVNEDGTEDT    281 - 350
SQPGRVQTFTFPETQFIAVTAYQNTDITQLKIDHNPFAKGFRDNYDTIYTGCDMDRLTPSPNDSPRSQIV    351 - 420
PGARYAMAGSFLQDQFVSNYAKARFHPGAGAGPGPGTDRSVPHTNGLLSPQQAEDPGAPSPQRWFVTPAN    421 - 490
NRLDFAASAYDTATDFAGNAATLLSYAAAGVKALPLQAAGCTGRPLGYYADPSGWGARSPPQYCGTKSGS    491 - 560
VLPCWPNSAAAAARMAGANPYLGEEAEGLAAERSPLPPGAAEDAKPKDLSDSSWIETPSSIKSIDSSDSG    561 - 630
IYEQAKRRRISPADTPVSESSSPLKSEVLAQRDCEKNCAKDISGYYGFYSHS                      631 - 682
//

Text Mined References (10)

PMID Year Title
25232744 2014 De novo TBR1 mutations in sporadic autism disrupt protein functions.
25201988 2014 Common genetic variants associated with cognitive performance identified using the proxy-phenotype method.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11719470 2001 TbetaR-I(6A) polymorphism is not a tumor susceptibility allele in Macedonian colorectal cancer patients. Correspondence re: B. Pasche et al. Type I TbetaR-I(6A) Is a Candidate Tumor Susceptibility Allele. Cancer Res., 58: 2727-2732, 1998.
10749215 2000 Nuclear translocation and transcription regulation by the membrane-associated guanylate kinase CASK/LIN-2.
7619531 1995 T-brain-1: a homolog of Brachyury whose expression defines molecularly distinct domains within the cerebral cortex.