Property Summary

NCBI Gene PubMed Count 9
PubMed Score 67.15
PubTator Score 36.41

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (5)

Disease Target Count Z-score Confidence
Neurodevelopmental Disorders 70 0.0 0.0
Disease Target Count Z-score Confidence
Autism spectrum disorder 101 0.0 5.0
Disease Target Count Z-score Confidence
Autistic Disorder 364 4.436 2.2
Microcephaly 166 3.72 1.9
Sleeping sickness 37 3.23 1.6

Expression

  Differential Expression (10)

Disease log2 FC p
astrocytic glioma -1.600 1.2e-03
Astrocytoma, Pilocytic -1.600 7.3e-04
atypical teratoid / rhabdoid tumor -1.500 1.4e-04
ependymoma -2.100 4.9e-04
glioblastoma -1.200 1.9e-03
group 3 medulloblastoma 2.700 7.2e-03
medulloblastoma, large-cell 2.500 3.7e-03
oligodendroglioma -1.500 5.3e-03
pediatric high grade glioma -1.300 5.3e-03
Pick disease -1.600 2.7e-03

Gene RIF (2)

AA Sequence

MQLEHCLSPSIMLSKKFLNVSSSYPHSGGSELVLHDHPIISTTDNLERSSPLKKITRGMTNQSDTDNFPD      1 - 70
SKDSPGDVQRSKLSPVLDGVSELRHSFDGSAADRYLLSQSSQPQSAATAPSAMFPYPGQHGPAHPAFSIG     71 - 140
SPSRYMAHHPVITNGAYNSLLSNSSPQGYPTAGYPYPQQYGHSYQGAPFYQFSSTQPGLVPGKAQVYLCN    141 - 210
RPLWLKFHRHQTEMIITKQGRRMFPFLSFNISGLDPTAHYNIFVDVILADPNHWRFQGGKWVPCGKADTN    211 - 280
VQGNRVYMHPDSPNTGAHWMRQEISFGKLKLTNNKGASNNNGQMVVLQSLHKYQPRLHVVEVNEDGTEDT    281 - 350
SQPGRVQTFTFPETQFIAVTAYQNTDITQLKIDHNPFAKGFRDNYDTIYTGCDMDRLTPSPNDSPRSQIV    351 - 420
PGARYAMAGSFLQDQFVSNYAKARFHPGAGAGPGPGTDRSVPHTNGLLSPQQAEDPGAPSPQRWFVTPAN    421 - 490
NRLDFAASAYDTATDFAGNAATLLSYAAAGVKALPLQAAGCTGRPLGYYADPSGWGARSPPQYCGTKSGS    491 - 560
VLPCWPNSAAAAARMAGANPYLGEEAEGLAAERSPLPPGAAEDAKPKDLSDSSWIETPSSIKSIDSSDSG    561 - 630
IYEQAKRRRISPADTPVSESSSPLKSEVLAQRDCEKNCAKDISGYYGFYSHS                      631 - 682
//

Text Mined References (11)

PMID Year Title