Property Summary

NCBI Gene PubMed Count 36
PubMed Score 90.67
PubTator Score 39.00

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (25)

Disease log2 FC p
acute myeloid leukemia 1.200 7.9e-03
acute quadriplegic myopathy 1.442 7.7e-04
adrenocortical carcinoma -2.340 1.6e-06
atypical teratoid / rhabdoid tumor -1.300 3.0e-03
Breast cancer -1.300 9.6e-04
chronic lymphosyte leukemia -1.100 2.5e-09
chronic rhinosinusitis -1.333 2.2e-02
diabetes mellitus -2.000 2.6e-02
glioblastoma 2.400 5.4e-03
hepatocellular carcinoma -1.200 4.0e-05
intraductal papillary-mucinous adenoma (... -2.200 7.9e-04
intraductal papillary-mucinous carcinoma... -1.700 7.3e-03
invasive ductal carcinoma -1.197 1.1e-02
juvenile dermatomyositis 1.318 6.1e-06
lung cancer -2.800 2.1e-03
lung carcinoma -1.800 1.9e-11
Multiple myeloma 1.696 2.5e-02
ovarian cancer -1.400 8.7e-04
pancreatic cancer 1.600 2.1e-02
pancreatic ductal adenocarcinoma liver m... -2.560 5.8e-03
pituitary cancer -2.100 5.3e-03
posterior fossa group A ependymoma 1.100 2.2e-03
psoriasis -1.900 7.9e-08
Rheumatoid arthritis 1.200 3.9e-02
tuberculosis and treatment for 6 months 1.200 1.2e-03

Protein-protein Interaction (5)

Gene RIF (19)

AA Sequence

MQLRKMQTVKKEQASLDASSNVDKMMVLNSALTEVSEDSTTGEELLLSEGSVGKNKSSACRRKREFIPDE      1 - 70
KKDAMYWEKRRKNNEAAKRSREKRRLNDLVLENKLIALGEENATLKAELLSLKLKFGLISSTAYAQEIQK     71 - 140
LSNSTAVYFQDYQTSKSNVSSFVDEHEPSMVSSSCISVIKHSPQSSLSDVSEVSSVEHTQESSVQGSCRS    141 - 210
PENKFQIIKQEPMELESYTREPRDDRGSYTASIYQNYMGNSFSGYSHSPPLLQVNRSSSNSPRTSETDDG    211 - 280
VVGKSSDGEDEQQVPKGPIHSPVELKHVHATVVKVPEVNSSALPHKLRIKAKAMQIKVEAFDNEFEATQK    281 - 350
LSSPIDMTSKRHFELEKHSAPSMVHSSLTPFSVQVTNIQDWSLKSEHWHQKELSGKTQNSFKTGVVEMKD    351 - 420
SGYKVSDPENLYLKQGIANLSAEVVSLKRLIATQPISASDSG                                421 - 462
//

Text Mined References (49)

PMID Year Title