Property Summary

NCBI Gene PubMed Count 34
Grant Count 32
R01 Count 22
Funding $2,362,756.36
PubMed Score 77.17
PubTator Score 39.00

Knowledge Summary

Patent

No data available

Expression

Gene RIF (17)

PMID Text
26102033 E4BP4 and BIM regulation correlated with that of RCAN1-1. A putative GRE and four EBPREs were identified within 1500bp upstream from the transcription start site of RCAN1-1
25338303 Results conclude that the transcriptional repressor E4BP4 plays a role in repressing epigenetically regulated SOSTDC1 expression in breast cancer cells, which can be reverted by E4BP4 silencing.
24280221 NFIL3 plays a neuroprotective role in neurons and constitutes a potential therapeutic target for neurodegeneration.
23630076 NFIL3 alters cancer cell behavior and FOXO function by acting on chromatin to restrict the menu of FOXO target genes
23340290 Data indicate that E4BP4 can inhibit CD40L expression through epigenetic modifications in the promoter region of CD40L.
23283977 G9a mediates E4BP4-dependent suppression of hepatic Fgf21 by enhancing histone methylation (H3K9me2) of the Fgf21 promoter
22947103 The clock-regulated and immune system modulator transcription factor E4BP4/ NFIL3 likely regulates the expression of both appb in zebrafish and APP in humans.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20186462 Conclude that E4BP4 plays as a survival factor in heart and E4BP4 is essential for proper embryonic heart development.
20174623 Observational study of gene-disease association. (HuGE Navigator)
More...

AA Sequence

MQLRKMQTVKKEQASLDASSNVDKMMVLNSALTEVSEDSTTGEELLLSEGSVGKNKSSACRRKREFIPDE      1 - 70
KKDAMYWEKRRKNNEAAKRSREKRRLNDLVLENKLIALGEENATLKAELLSLKLKFGLISSTAYAQEIQK     71 - 140
LSNSTAVYFQDYQTSKSNVSSFVDEHEPSMVSSSCISVIKHSPQSSLSDVSEVSSVEHTQESSVQGSCRS    141 - 210
PENKFQIIKQEPMELESYTREPRDDRGSYTASIYQNYMGNSFSGYSHSPPLLQVNRSSSNSPRTSETDDG    211 - 280
VVGKSSDGEDEQQVPKGPIHSPVELKHVHATVVKVPEVNSSALPHKLRIKAKAMQIKVEAFDNEFEATQK    281 - 350
LSSPIDMTSKRHFELEKHSAPSMVHSSLTPFSVQVTNIQDWSLKSEHWHQKELSGKTQNSFKTGVVEMKD    351 - 420
SGYKVSDPENLYLKQGIANLSAEVVSLKRLIATQPISASDSG                                421 - 462
//

Text Mined References (46)

PMID Year Title
26102033 2015 Glucocorticoid-mediated co-regulation of RCAN1-1, E4BP4 and BIM in human leukemia cells susceptible to apoptosis.
25772364 2015 SUMO-2 Orchestrates Chromatin Modifiers in Response to DNA Damage.
25755297 2015 System-wide Analysis of SUMOylation Dynamics in Response to Replication Stress Reveals Novel Small Ubiquitin-like Modified Target Proteins and Acceptor Lysines Relevant for Genome Stability.
25609649 2015 Proteomic analyses reveal distinct chromatin-associated and soluble transcription factor complexes.
25416956 2014 A proteome-scale map of the human interactome network.
25338303 2014 E4BP4 is a repressor of epigenetically regulated SOSTDC1 expression in breast cancer cells.
25218447 2014 Uncovering global SUMOylation signaling networks in a site-specific manner.
25114211 2014 Mapping of SUMO sites and analysis of SUMOylation changes induced by external stimuli.
24280221 2014 Neuroprotective role of the basic leucine zipper transcription factor NFIL3 in models of amyotrophic lateral sclerosis.
23630076 2013 Survival factor NFIL3 restricts FOXO-induced gene expression in cancer.
More...