Property Summary

NCBI Gene PubMed Count 34
PubMed Score 77.17
PubTator Score 39.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
lung carcinoma 2844 1.88665006376413E-11
chronic lymphosyte leukemia 232 2.47848819538732E-9
psoriasis 6685 7.87643307743482E-8
lung cancer 4473 1.1437692911881E-6
adrenocortical carcinoma 1427 1.61143126839203E-6
juvenile dermatomyositis 1189 6.11512450788821E-6
hepatocellular carcinoma 550 3.99758224005649E-5
ovarian cancer 8492 3.82218826263221E-4
acute quadriplegic myopathy 1157 7.67111112142521E-4
intraductal papillary-mucinous adenoma (IPMA) 2956 7.92498963209275E-4
Breast cancer 3099 9.63244975951506E-4
atypical teratoid/rhabdoid tumor 1095 0.00107802445294916
tuberculosis and treatment for 6 months 686 0.00120354990311175
posterior fossa group A ependymoma 1511 0.00223349872235671
pituitary cancer 1972 0.00532043004173914
glioblastoma 5572 0.00537937049076336
pancreatic ductal adenocarcinoma liver metastasis 1795 0.00580272947874586
intraductal papillary-mucinous carcinoma (IPMC) 2988 0.00733353807346875
acute myeloid leukemia 785 0.00792507167722858
invasive ductal carcinoma 2950 0.0110016141584568
pancreatic cancer 2300 0.0213103541164254
chronic rhinosinusitis 512 0.0215354368310021
Multiple myeloma 1328 0.0254275776974123
diabetes mellitus 1663 0.0263401501927902
Rheumatoid Arthritis 1171 0.0388936582167804
Disease Target Count Z-score Confidence
Intestinal disease 11 0.0 1.0

Expression

Synonym

Accession Q16649 B2R9Y8 Q14211 Q6FGQ8 Q96HS0
Symbols E4BP4
IL3BP1
NFIL3A
NF-IL3A

Gene

PANTHER Protein Class (1)

  Ortholog (11)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA Inparanoid
Rat OMA Inparanoid
Dog OMA Inparanoid
Cow OMA EggNOG Inparanoid
Pig OMA Inparanoid
Opossum OMA Inparanoid
Chicken OMA Inparanoid
Anole lizard OMA Inparanoid
Xenopus OMA EggNOG Inparanoid

Gene RIF (17)

PMID Text
26102033 E4BP4 and BIM regulation correlated with that of RCAN1-1. A putative GRE and four EBPREs were identified within 1500bp upstream from the transcription start site of RCAN1-1
25338303 Results conclude that the transcriptional repressor E4BP4 plays a role in repressing epigenetically regulated SOSTDC1 expression in breast cancer cells, which can be reverted by E4BP4 silencing.
24280221 NFIL3 plays a neuroprotective role in neurons and constitutes a potential therapeutic target for neurodegeneration.
23630076 NFIL3 alters cancer cell behavior and FOXO function by acting on chromatin to restrict the menu of FOXO target genes
23340290 Data indicate that E4BP4 can inhibit CD40L expression through epigenetic modifications in the promoter region of CD40L.
23283977 G9a mediates E4BP4-dependent suppression of hepatic Fgf21 by enhancing histone methylation (H3K9me2) of the Fgf21 promoter
22947103 The clock-regulated and immune system modulator transcription factor E4BP4/ NFIL3 likely regulates the expression of both appb in zebrafish and APP in humans.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20186462 Conclude that E4BP4 plays as a survival factor in heart and E4BP4 is essential for proper embryonic heart development.
20174623 Observational study of gene-disease association. (HuGE Navigator)
More...

AA Sequence

MQLRKMQTVKKEQASLDASSNVDKMMVLNSALTEVSEDSTTGEELLLSEGSVGKNKSSACRRKREFIPDE      1 - 70
KKDAMYWEKRRKNNEAAKRSREKRRLNDLVLENKLIALGEENATLKAELLSLKLKFGLISSTAYAQEIQK     71 - 140
LSNSTAVYFQDYQTSKSNVSSFVDEHEPSMVSSSCISVIKHSPQSSLSDVSEVSSVEHTQESSVQGSCRS    141 - 210
PENKFQIIKQEPMELESYTREPRDDRGSYTASIYQNYMGNSFSGYSHSPPLLQVNRSSSNSPRTSETDDG    211 - 280
VVGKSSDGEDEQQVPKGPIHSPVELKHVHATVVKVPEVNSSALPHKLRIKAKAMQIKVEAFDNEFEATQK    281 - 350
LSSPIDMTSKRHFELEKHSAPSMVHSSLTPFSVQVTNIQDWSLKSEHWHQKELSGKTQNSFKTGVVEMKD    351 - 420
SGYKVSDPENLYLKQGIANLSAEVVSLKRLIATQPISASDSG                                421 - 462
//

Text Mined References (46)

PMID Year Title
26102033 2015 Glucocorticoid-mediated co-regulation of RCAN1-1, E4BP4 and BIM in human leukemia cells susceptible to apoptosis.
25772364 2015 SUMO-2 Orchestrates Chromatin Modifiers in Response to DNA Damage.
25755297 2015 System-wide Analysis of SUMOylation Dynamics in Response to Replication Stress Reveals Novel Small Ubiquitin-like Modified Target Proteins and Acceptor Lysines Relevant for Genome Stability.
25609649 2015 Proteomic analyses reveal distinct chromatin-associated and soluble transcription factor complexes.
25416956 2014 A proteome-scale map of the human interactome network.
25338303 2014 E4BP4 is a repressor of epigenetically regulated SOSTDC1 expression in breast cancer cells.
25218447 2014 Uncovering global SUMOylation signaling networks in a site-specific manner.
25114211 2014 Mapping of SUMO sites and analysis of SUMOylation changes induced by external stimuli.
24280221 2014 Neuroprotective role of the basic leucine zipper transcription factor NFIL3 in models of amyotrophic lateral sclerosis.
23630076 2013 Survival factor NFIL3 restricts FOXO-induced gene expression in cancer.
More...