Property Summary

NCBI Gene PubMed Count 81
PubMed Score 341.79
PubTator Score 138.85

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (5)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.8

Expression

  Differential Expression (25)

Disease log2 FC p
adrenocortical carcinoma -1.239 2.3e-02
Atopic dermatitis -1.600 3.0e-03
atypical teratoid/rhabdoid tumor 1.200 3.8e-03
Breast cancer -1.200 4.6e-02
breast carcinoma -1.100 2.6e-09
colon cancer -1.200 4.8e-03
cystic fibrosis -1.458 8.8e-04
ductal carcinoma in situ -1.400 4.0e-02
gastric carcinoma 2.000 2.7e-02
Gaucher disease type 3 -1.500 2.5e-02
group 3 medulloblastoma -1.300 4.9e-02
intraductal papillary-mucinous adenoma (... -2.500 1.9e-03
intraductal papillary-mucinous carcinoma... -3.800 3.8e-05
intraductal papillary-mucinous neoplasm ... -3.600 1.3e-03
invasive ductal carcinoma -2.600 4.0e-03
lung adenocarcinoma -1.300 2.3e-05
lung cancer -1.100 2.3e-02
lung carcinoma -2.300 2.1e-16
malignant mesothelioma -8.600 3.0e-10
non-small cell lung cancer -1.226 2.2e-05
osteosarcoma 1.477 5.3e-04
ovarian cancer -5.500 1.0e-19
pancreatic cancer 2.800 1.0e-04
primary pancreatic ductal adenocarcinoma 2.591 1.1e-03
psoriasis -1.100 3.4e-03

 GWAS Trait (1)

Gene RIF (70)

AA Sequence

MAWAALLGLLAALLLLLLLSRRRTRRPGEPPLDLGSIPWLGYALDFGKDAASFLTRMKEKHGDIFTILVG      1 - 70
GRYVTVLLDPHSYDAVVWEPRTRLDFHAYAIFLMERIFDVQLPHYSPSDEKARMKLTLLHRELQALTEAM     71 - 140
YTNLHAVLLGDATEAGSGWHEMGLLDFSYSFLLRAGYLTLYGIEALPRTHESQAQDRVHSADVFHTFRQL    141 - 210
DRLLPKLARGSLSVGDKDHMCSVKSRLWKLLSPARLARRAHRSKWLESYLLHLEEMGVSEEMQARALVLQ    211 - 280
LWATQGNMGPAAFWLLLFLLKNPEALAAVRGELESILWQAEQPVSQTTTLPQKVLDSTPVLDSVLSESLR    281 - 350
LTAAPFITREVVVDLAMPMADGREFNLRRGDRLLLFPFLSPQRDPEIYTDPEVFKYNRFLNPDGSEKKDF    351 - 420
YKDGKRLKNYNMPWGAGHNHCLGRSYAVNSIKQFVFLVLVHLDLELINADVEIPEFDLSRYGFGLMQPEH    421 - 490
DVPVRYRIRP                                                                491 - 500
//

Text Mined References (82)

PMID Year Title