Property Summary

NCBI Gene PubMed Count 81
Grant Count 138
R01 Count 62
Funding $12,412,823.95
PubMed Score 316.95
PubTator Score 138.85

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (25)

Synonym

Accession Q16647 Q3MII8 Q9HAX2 Q9HAX3 Q9HAX4
Symbols CYP8
PGIS
PTGI
CYP8A1

Gene

PANTHER Protein Class (1)

PDB

2IAG   3B6H  

 GWAS Trait (1)

Gene RIF (70)

PMID Text
26130461 In examining the tumor suppressor PTGIS as a potential biomarker for treatment with either 5-Aza-dC or TSA, 5-Aza-dC effectively stabilized cell cycling, restricted genetic instability and derepressed PTGIS expression
25623425 Based on the predicted crystal structure of CYP8A1( *)5 using the Molecular Operating Environment platform, the distance from CYP8A1 Cys441 to the heme was altered with a significantly changed binding free energy for the mutant protein.
25256272 results indicate that PGIS expression was associated with radiotherapy efficiency
24605778 In a case-control study unaffected carriers of a BMPR2 mutation, linked to pulmonary artery hypertension (PAH), were most often found to have prostacyclin synthase promoter sequence variants, which were thought to protect against PAH.
24225501 Type-2 diabetes is associated with higher COX-2 expression, but lower eNOS and PGIS expression in subcutaneous arteries.
23807031 These findings suggest that PGIS is induced by hypoxia and regulates the expression of VEGF in fibroblasts.
22219064 High PTGIS expression is associated with colorectal cancer hepatic metastasis.
22109564 Overexpression of PTGIS is associated with liver metastasis in colon cancer.
22072641 The CC genotype of C1117A polymorphism is associated with higher risk of LM-CAD
21052031 Observational study of gene-disease association, gene-gene interaction, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
More...

AA Sequence

MAWAALLGLLAALLLLLLLSRRRTRRPGEPPLDLGSIPWLGYALDFGKDAASFLTRMKEKHGDIFTILVG      1 - 70
GRYVTVLLDPHSYDAVVWEPRTRLDFHAYAIFLMERIFDVQLPHYSPSDEKARMKLTLLHRELQALTEAM     71 - 140
YTNLHAVLLGDATEAGSGWHEMGLLDFSYSFLLRAGYLTLYGIEALPRTHESQAQDRVHSADVFHTFRQL    141 - 210
DRLLPKLARGSLSVGDKDHMCSVKSRLWKLLSPARLARRAHRSKWLESYLLHLEEMGVSEEMQARALVLQ    211 - 280
LWATQGNMGPAAFWLLLFLLKNPEALAAVRGELESILWQAEQPVSQTTTLPQKVLDSTPVLDSVLSESLR    281 - 350
LTAAPFITREVVVDLAMPMADGREFNLRRGDRLLLFPFLSPQRDPEIYTDPEVFKYNRFLNPDGSEKKDF    351 - 420
YKDGKRLKNYNMPWGAGHNHCLGRSYAVNSIKQFVFLVLVHLDLELINADVEIPEFDLSRYGFGLMQPEH    421 - 490
DVPVRYRIRP                                                                491 - 500
//

Text Mined References (81)

PMID Year Title
26130461 2015 Evaluation of Epigenetic Drug Targeting of Heterogenous Tumor Cell Fractions Using Potential Biomarkers of Response in Ovarian Cancer.
25623425 2015 Analysis of genetic polymorphism and biochemical characterization of a functionally decreased variant in prostacyclin synthase gene (CYP8A1) in humans.
25256272 2015 Prostacyclin-synthase expression in head and neck carcinoma patients and its prognostic value in the response to radiotherapy.
25056061 2014 Biological insights from 108 schizophrenia-associated genetic loci.
24605778 2014 Functional prostacyclin synthase promoter polymorphisms. Impact in pulmonary arterial hypertension.
24225501 2013 Reduced expression of prostacyclin synthase and nitric oxide synthase in subcutaneous arteries of type 2 diabetic patients.
23807031 2013 VEGF expression is augmented by hypoxia?induced PGIS in human fibroblasts.
22219064 2012 Combination of haptoglobin and osteopontin could predict colorectal cancer hepatic metastasis.
22109564 2012 Overexpression of PTGIS could predict liver metastasis and is correlated with poor prognosis in colon cancer patients.
22072641 2012 CYP8A1 gene polymorphisms and left main coronary artery disease.
More...